KEGG   Mycoplasma putrefaciens KS1: MPUT_0557Help
Entry
MPUT_0557         CDS       T01599                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
mpf00010  Glycolysis / Gluconeogenesis
mpf00020  Citrate cycle (TCA cycle)
mpf00620  Pyruvate metabolism
mpf01100  Metabolic pathways
mpf01110  Biosynthesis of secondary metabolites
mpf01120  Microbial metabolism in diverse environments
mpf01130  Biosynthesis of antibiotics
mpf01200  Carbon metabolism
Module
mpf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPUT_0557 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MPUT_0557 (pdhC)
   00620 Pyruvate metabolism
    MPUT_0557 (pdhC)
Enzymes [BR:mpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MPUT_0557 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 NQRA HlyD_D23 HlyD_3 RnfC_N GCV_H PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AEM68912
Position
complement(640234..641532)
Genome map
AA seq 432 aa AA seqDB search
MYQVKFADIGEGLTEGTVAEVLVKIGDTVKAGQALYFVETDKVNSEIPAPIDGKIAKINI
SAGQEIKVGDIVMEIDDGSGAAVAATPKAEQSKAETKVEQIEENASVVGATPVSNELITR
NVQSVSTTNKQIKATPLARKVAADLKVDLSSLTGTGPNGRILVADVKNAQAASVQTASQT
PASEPSQAAVSMPQIIDVNAPLSWDTINMNGIRKATVKAMVKSHTEIAAFTGMKNVDITA
THKMRSELKDHAASSGIKLTYLAFIIKACAKALRDMPNINARGDFANNKIQYMHNINIGI
AVDTTQGLMVPVIKGADRLSLFEIAIKITELANKAKDGKLSMKEMTEATFTVSNFGSVGL
DYATPIINSPESAILGVGTMTQTPMYVNGEVQPRFIMPFSMTCDHRIIDGADAGRFLIKV
QEYLAKPILLFT
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagttaaatttgctgatatcggtgaaggtttaacagaaggaacagttgcagaa
gttttagtcaaaattggagatactgtcaaagcaggtcaagctctttattttgttgaaact
gataaagttaacagtgaaattccagctccaattgatggaaagattgctaaaattaatatt
tctgcaggtcaagaaattaaagttggtgatattgtgatggaaattgatgatggaagcggt
gctgcagttgcagctacacctaaagctgaacaatctaaagctgaaacaaaagttgagcaa
atcgaagaaaacgctagtgtagttggagcaactcctgtttcaaacgaactaattacaaga
aatgtacaatcagtatcaacaacaaataagcaaattaaagcaactcctttggccagaaaa
gtagctgctgatttaaaagttgatttgtcatcactaacaggtacaggaccaaacggtaga
attctagtagctgatgttaaaaatgcccaagccgcatcagttcaaactgcaagtcaaaca
ccagcttctgaaccaagtcaagccgctgtttcaatgcctcaaatcatagatgttaacgca
ccattatcatgagacactattaacatgaatggaatcagaaaagcaacagttaaagcaatg
gttaaatctcatactgaaattgctgcatttactggtatgaaaaacgttgatattactgca
actcataaaatgagatcagaattaaaagatcatgccgcaagttctggaattaaactaact
tatttagcatttattattaaagcttgtgctaaggctttgcgtgatatgccaaatattaat
gcgcgaggagattttgcaaacaacaaaatccaatacatgcataacatcaatattggtatt
gctgttgatactactcaagggctaatggttccagtaattaaaggtgctgatagattaagc
ttatttgaaattgcaattaaaattactgaactagctaataaagcaaaagacggaaaatta
tcaatgaaagaaatgactgaagcaacctttacagtttcaaactttggttcagtcggatta
gattatgccactccaattattaactcacctgaatctgcaattttaggagttggaacaatg
actcaaactccaatgtatgtaaatggtgaagttcaaccaagatttattatgccattttct
atgacttgtgatcacagaattattgatggtgctgatgctggaaggttcttaattaaagtt
caagaatacctagcaaaaccaattttattatttacttaa

DBGET integrated database retrieval system