KEGG   Mycoplasma putrefaciens KS1: MPUT_0600Help
Entry
MPUT_0600         CDS       T01599                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPUT_0600 (tpiA)
   01230 Biosynthesis of amino acids
    MPUT_0600 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPUT_0600 (tpiA)
   00051 Fructose and mannose metabolism
    MPUT_0600 (tpiA)
   00562 Inositol phosphate metabolism
    MPUT_0600 (tpiA)
Enzymes [BR:mpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPUT_0600 (tpiA)
Exosome [BR:mpf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPUT_0600 (tpiA)
  Exosomal proteins of bladder cancer cells
   MPUT_0600 (tpiA)
  Exosomal proteins of melanoma cells
   MPUT_0600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(696805..697557)
Genome map
AA seq 250 aa AA seqDB search
MRKTVIFGNWKMNGTNQSIKDFLSITDNKINDKNVVAGLAVPFTLLQIAKQLTKNIKIAA
QNVHFQENGAFTGEISPLMLKDLNVDYAIVGHSERREMFCETDQMINQKVKILLKHNIIP
IICCGESLEIKQVAKTIDFVNNQIIQALKDVTADQVVKIIIAYEPIWAIGTGKTATAQDA
ELVCQAIRDNLASIYDQKIADQIIIQYGGSVKPNNIKEYLQMPNIDGALVGGASLQADDY
LELINYEQKN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacagttatttttggaaactgaaagatgaatggtacaaatcaaagtatcaaa
gattttttaagcattactgataataaaataaacgataaaaatgttgttgctggactagcg
gttccttttactttgcttcaaatagcaaaacagttaactaaaaatattaaaatagctgca
caaaatgttcattttcaagaaaatggtgcatttactggtgaaatttcaccactgatgtta
aaagatttaaatgttgattatgcaatagttggccactctgaaagaagagaaatgttttgt
gaaactgatcaaatgattaatcaaaaagttaaaattctattaaaacataatataatacca
attatttgttgtggtgagtctttagaaattaaacaagtagcaaaaaccattgattttgta
aacaatcaaataattcaagcacttaaagatgtaacagctgatcaagtagttaaaataatt
attgcttatgaacccatttgagcaattggcacaggtaaaactgcaacagctcaagacgct
gaattagtatgtcaagcaattagagataatctggcatctatttatgatcaaaaaatagct
gatcaaattattattcaatatggtggaagtgtaaaaccaaataatattaaagaatatcta
caaatgccaaatattgatggagcattagttggtggagcttcgttacaagctgatgattat
ttagaattaataaattatgaacaaaaaaattaa

DBGET integrated database retrieval system