KEGG   Mycoplasma putrefaciens KS1: MPUT_0701Help
Entry
MPUT_0701         CDS       T01599                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MPUT_0701 (pncA)
Enzymes [BR:mpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MPUT_0701 (pncA)
    3.5.1.-  
     MPUT_0701 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808418..808900
Genome map
AA seq 160 aa AA seqDB search
MNKALIIVDYQYDFACSNGSLYVKGAEELSNKIFELSKKRKQQGWIVVATKDWHPKNHCS
FNQWPSHCVQNTKGSELYFDSTYVDLIIQKGHDKNTESYSGFFDDKGRSNHLNEYLKQNN
VTELEIVGVVTEICVKATYDDAVKLGYNAYVNLEYCKGFE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagctttaattatagttgattatcaatatgactttgcttgtagtaacggtagt
ttgtatgtaaaaggtgctgaagagctaagtaataaaatatttgaattatctaaaaaaaga
aaacaacaaggatgaatagtagtagctactaaggactgacatcctaaaaatcattgttct
ttcaatcagtgacctagtcattgtgttcaaaatactaaaggatcagaactgtattttgac
tcaacttatgtagatttaattattcaaaaaggtcacgataaaaatactgaaagttatagt
ggtttttttgatgataaaggtagatcaaatcatttaaatgaatatctgaaacaaaataat
gttactgaactagaaatagttggagttgttactgaaatatgtgtaaaagcaacttatgat
gatgcagttaaacttggatataatgcatatgtaaatttagaatattgtaaaggttttgaa
taa

DBGET integrated database retrieval system