KEGG   Mycoplasma putrefaciens KS1: MPUT_0717Help
Entry
MPUT_0717         CDS       T01599                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mpf  Mycoplasma putrefaciens KS1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(825748..826338)
Genome map
AA seq 196 aa AA seqDB search
MSEVLFDKIVEKIKNTKGLTKKTSERLLSDLIMSKNKLEEFIDQLILLKEHISICKICGY
LSEDKQCLVCDLQKRNTDSICVVSSILDAKNIETINKYKGVYHILNGEINLNRNITPDKL
NVNKLLERINSNSEVILALNATFEGELTANYLNKLLSEQNIKVTRLAKGIPMGASLDYMD
EYTLENAFNNRKKYGE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtattatttgacaaaatagttgaaaaaatcaaaaatactaaaggtttaact
aaaaaaacttcagaaagattattaagtgatttaatcatgagtaaaaataaattagaagaa
tttattgatcagttaattttattaaaagaacatatttcaatatgtaaaatttgtggttat
ttgtcagaagacaagcaatgcttagtttgtgatttacaaaaaagaaatactgattctatt
tgtgtggttagctcaatacttgatgctaaaaatattgaaacaattaataaatataaaggt
gtttatcatatcttaaatggagaaatcaatttaaatagaaatatcaccccagataaacta
aatgttaataaattattagaaagaatcaactctaattctgaagtgatcttagctttaaat
gctacttttgaaggtgaattaacagcaaattatttaaataaattgctatctgaacaaaac
attaaagttactaggcttgctaaaggaataccaatgggagcaagtttggattatatggac
gaatacacattagaaaatgcttttaacaatagaaaaaaatatggagaatag

DBGET integrated database retrieval system