KEGG   Mesotoga prima: Theba_0026Help
Entry
Theba_0026        CDS       T02123                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpg  Mesotoga prima
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theba_0026
   00670 One carbon pool by folate
    Theba_0026
Enzymes [BR:mpg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Theba_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24941..25441)
Genome map
AA seq 166 aa AA seqDB search
MKVIAVFASTLNGKISLSEDDKTEWTSREDKRYFKSLTSSVGIVIMGRKTHEAIGRALPD
RLNIVLTRNPDYYRPSENLIFTSSTPKELLEDLEKKGHDEVCLIGGAETFDHFADLGLVN
ELHITFEPIIRTGIAGLGETMERDLDLSLKEFRKLGEAILTVYEVK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtcattgcggtttttgcaagtacgttgaatggaaagatctcattatcagaagac
gataagacagagtggacatcgagagaagacaaaaggtacttcaaatccctgacctcaagt
gtcggcatagtgataatggggaggaagacccacgaagctatcgggagggcccttcctgac
aggctcaacatcgtattgacgagaaatccagactattatagaccatccgaaaacctcatc
ttcacatcctcaaccccaaaagaacttctcgaagatttggagaaaaaggggcacgatgag
gtgtgcttgattggcggcgccgagactttcgatcactttgcggatttgggcctggtcaat
gaactccacattacttttgaaccgatcataagaacgggcatcgccgggttgggagaaact
atggaacgcgacctagatctcagcctaaaggagtttcgaaaactcggggaagcaattcta
accgtatacgaagtcaaataa

DBGET integrated database retrieval system