KEGG   Mesotoga prima: Theba_0160Help
Entry
Theba_0160        CDS       T02123                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpg  Mesotoga prima
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theba_0160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theba_0160
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theba_0160
Enzymes [BR:mpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theba_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169273..170319
Genome map
AA seq 348 aa AA seqDB search
MKGVIESYEKFLPITPKTPKITLLEGNTPLIYLENISKQYGVKVYVKYEGANPTGSFKDR
GMVLAIAKAIEEGSRAVICASTGNTSASAAAYSARTGLKSIILIPEGKIAIGKLAQAMIY
GAKVIQIDGNFDNCLELAKKISENYPVTLVNSLNPYRLEGQKTAAFEIIDVLGRAPDYHF
IPVGNAGNISAYWMGYREYREKGLSESQPRMMGFQAEGAAPIVYDRVFEHPETIATAIRI
GNPASWKKAVAARDESGGVIEALTDEEILHAQKLLASAEGVFCEPASAASFGGFLRKARE
GLFEASDIAVCTLTGNGLKDPDAVLKSVDRPLVVENDLEVVLKEAGLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagtcatagagagttatgagaagttcctgcctataacaccgaagactccaaaa
ataacgcttctagaagggaacactcccttgatctaccttgagaacataagcaaacagtac
ggggtgaaagtctatgtgaagtatgagggcgcaaatccgacgggctccttcaaagacagg
gggatggtccttgcaattgcaaaagcgatcgaagaaggctcaagagcggttatctgcgcc
tcgacagggaacacctctgcctctgcggcggcgtactccgcccggaccggcctgaaatcg
ataattctaattcccgagggtaagatcgcgatagggaagctagcgcaggcaatgatctac
ggggcaaaggtaatccagatagacgggaatttcgataactgccttgaactggccaagaag
atctctgagaactatcccgtcacgctcgtgaacagtctaaatccttacagactagaaggt
cagaaaacggccgccttcgagatcatagatgttttgggacgtgccccggactatcacttc
atcccggtgggaaacgcgggcaacatttccgcctactggatgggctacagggagtatcgt
gagaagggactgtcggaatcccagcccagaatgatgggctttcaggcagagggagcggcc
cctatcgtatacgatagagttttcgagcatcccgagaccatcgcgaccgctattagaatc
ggtaatcccgcaagctggaaaaaggcagttgctgcaagagacgagtcgggaggcgttatc
gaggcactgacagacgaagagatccttcacgctcagaaactcctggccagcgcggagggc
gtcttctgcgaaccagcctctgcggcttccttcggcggatttctcaggaaggcgcgagag
ggtctttttgaagcaagtgatattgccgtctgcacacttaccggaaacggacttaaggat
cccgatgcagtcttgaagtctgtagacaggcctcttgtggttgagaatgatctcgaggta
gttctgaaagaggcgggcttgaagtga

DBGET integrated database retrieval system