KEGG   Mesotoga prima: Theba_0167Help
Entry
Theba_0167        CDS       T02123                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpg  Mesotoga prima
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mpg00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mpg00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179331..180377
Genome map
AA seq 348 aa AA seqDB search
MRGVIETYEKYLPVTQKTPRVSLLEGDTPLIHLEKASKKFGLNVYAKYEGANPTGSFKDR
GMVLAIAKAIEEGSKAVICASTGNTSASAAAYSARTGLKSIILIPEGKIALGKLAQAMIY
GAKVIQIDGNFDECLELAKSISENYPVTLVNSLNPYRLEGQKTAAFEIVDVLGRAPDYHF
IPVGNAGNITAYWMGYREYHESGLSDGLPKMMGFQAEGAAPIVYDRVFDNPETIATAIRI
GNPASWKKAVAARDESEGVIEALTDEEILEAQRLLAASEGVFCEPASAASFGGFLRKAEE
GLFCSSDLVVCTLTGNGLKDPDAVLKSVDKPIVVENSLDAVLKEAGLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtgtaatagagacctatgagaagtacctgcctgtaacgcagaagaccccgaga
gtctcactccttgaaggtgatactcctctaatacatctggaaaaggcgagcaagaagttc
ggtttaaatgtttatgctaagtacgaaggagctaatcctactggatcattcaaagacagg
ggaatggtcctcgcgatagccaaagcgatagaagagggctcaaaggctgttatttgtgcc
tccactggaaacacttcggcctctgcagccgcttactctgcaaggaccggtttgaagtcg
ataatcttgattccggagggaaagatcgctctaggcaagcttgctcaggcgatgatctat
ggcgcaaaggtaattcagatagatgggaatttcgatgagtgccttgaactagcgaagagt
atatcggagaattaccccgttactctcgttaacagtctcaacccttacaggcttgagggg
cagaaaacggctgccttcgaaatagtagacgttctgggaagggctcccgattatcacttc
ataccggtaggaaatgccggtaatattactgcctactggatggggtatcgagagtatcac
gaaagtggtctttcagacggcctgcccaagatgatgggcttccaggccgaaggggcagca
ccgatagtatatgacagagtcttcgataaccccgagacgatagctaccgcgataagaatt
ggtaaccctgcgagttggaagaaagcagttgctgcaagagacgaatcggaaggagtgatc
gaggctttgaccgacgaagaaatcctcgaggcgcagagacttcttgcggcttctgaaggt
gtcttctgtgagccggcttctgcagcttctttcggcgggtttctgagaaaagccgaagag
ggtctgttctgttcaagtgatctcgttgtctgtaccctgacaggtaatggacttaaagat
cccgacgccgttctcaagtccgtagataagcccatcgtagtagagaacagtctggatgct
gtcctgaaagaggcgggcctgaaatga

DBGET integrated database retrieval system