KEGG   Mesotoga prima: Theba_0169Help
Entry
Theba_0169        CDS       T02123                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpg  Mesotoga prima
Pathway
mpg00250  Alanine, aspartate and glutamate metabolism
mpg01100  Metabolic pathways
mpg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Theba_0169
Enzymes [BR:mpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Theba_0169
Peptidases [BR:mpg01002]
 Cysteine Peptidases
  Family C44
   Theba_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase YonK QueC
Motif
Other DBs
NCBI-ProteinID: AFK05909
UniProt: I2F1V6
Position
complement(181247..182674)
Genome map
AA seq 475 aa AA seqDB search
MSGIAVFYGGTREMAKSSLSLLGHRGSRTTVLETGQKIGMGAVVSRAFDSKMSIFEGDGE
YVVFDGFLRNHPDTAWPEKIMKLYKESGRGFLKELDGSFAFAIYTDKETLIARDPLGLKP
LYYGYINGYIVCTSEMKALAPFCNEVKIFPPGHYYSSLVGFERYSSLEDLLTEEPVMRNE
YEATELLRTSLGEAIENRISSINSDPIVFLSGGLDSSCIAAVASSLNGSLRTFTVGSGDG
KDPKFAREVSEYLGTDHSEYTYDFKEMLRTLPEVIYHLESFDPPLVRSAIPNYIVAKMAA
EEGSSFVFMGEGADELFAGYEYMKELPSSESIDEESLRITRNGYRSGFQRNDRMSLAFGI
EFDVPFMDPSVVNLAFSIPVDWKIHGPEKTEKWILRKAFESELPKSVVWRKKSKFSVGSG
SSHLMKEYAEEKISDSEFETERREKGIRSKEELLYYRIFDDLFPSGCAAKTVYRS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaattgctgtcttctatggaggcacaagagaaatggcaaagtcctcactgtct
ctccttggacatagagggagcagaacaacagttctggaaacaggacagaagataggcatg
ggcgcagttgtcagccgggccttcgacagcaaaatgagcattttcgaaggagatggcgag
tacgttgtcttcgacggttttctcaggaatcatccggacacagcttggccagagaagata
atgaaattgtataaggaaagtggcagggggtttctgaaggagctggacggttcattcgcc
tttgcaatttatacagacaaagagactcttatcgcgcgtgaccctctgggtctaaagcct
ttgtactacggctatatcaatggatacatagtatgcacatcagaaatgaaggctctggcg
cccttctgcaacgaagtaaaaatcttcccgccgggtcattattattcctctctcgtgggc
tttgagagatattcttctcttgaagacctgcttacggaggaacccgtcatgagaaatgag
tatgaagcaacggagctgcttcgaacatctcttggagaggccatcgagaatagaatctct
tcgatcaactcagaccctatcgtatttcttagcggtgggctcgatagcagctgtatagcg
gctgtggcgagttctcttaatggatcgcttagaacattcaccgttggaagcggggatgga
aaagacccaaaattcgccagggaagtctccgagtatctcgggacagaccacagtgaatat
acttatgatttcaaagagatgcttaggactctaccggaagtcatctaccaccttgagtcg
ttcgatcctcccttagtaaggagtgcaattccaaactacattgtggcgaaaatggctgca
gaagaaggtagttccttcgtcttcatgggagaaggcgcagacgaactctttgccggttac
gagtatatgaaagaactaccatcttcagaatctatagatgaagaatctttgcggataacg
agaaacggttatcgttcgggctttcagcgcaatgacaggatgtccctagcatttgggatc
gagttcgacgttccgttcatggacccttcagttgtgaatctcgcattctcaattcccgtc
gattggaaaatccacgggcctgagaagaccgagaagtggattctcaggaaggcattcgag
agcgaacttcccaaaagtgtcgtatggcgaaaaaagagtaagttcagcgtcggctcaggc
tcatcgcacctaatgaaggaatatgctgaagagaaaataagcgattccgaattcgagact
gaaaggcgagagaaaggaattaggtcgaaggaagaacttctttattaccgaatcttcgac
gacttgttcccttccggatgcgccgcgaaaacagtttacagaagctga

DBGET integrated database retrieval system