KEGG   Mesotoga prima: Theba_0358Help
Entry
Theba_0358        CDS       T02123                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mpg  Mesotoga prima
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Theba_0358
Enzymes [BR:mpg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Theba_0358
Amino acid related enzymes [BR:mpg01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Theba_0358
Transfer RNA biogenesis [BR:mpg03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Theba_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
392754..394202
Genome map
AA seq 482 aa AA seqDB search
MIRVRFAPSPTGYLHVGGARTALFNYLFARHYGGKLVLRVEDTDISRSTKEYEDQLMESL
LWLGITWDEGPDVGGAFGPYRQSERGPIYREMIGDLLQRGQAYEVHAYPEEIEELHDKLL
SEGKAPHYDQEMLEAFNTDERISEFESKGLRPVVFFKMPRKEYRLPDLIKGEVVFKEGAI
GDFVIMRSNGQPIYNFAVVADDITMEISHVIRGDDHLSNTLRQLALYEAFGAPIPSFAHV
SMILGPDGKKLSKRHGDTSVEQFRERGFLPEAFFNFLTLLGWSHPDGKEILNHEEIVESF
SIERVNTSAAIFDEAKAKWMNGVYIRESDLERITDLAVPFIIQSKLMTAEDAVANRKWLK
RAVDSVRKGVETLSEIPDKMRLYFEDPQVTFFTPSNDVEKGVYKALEAFKERVEYLDSWN
NDEIIGTIRGILKDLKPDRKAFYMTLRKILTSVEEGPELVDIIFLLGRNKTLNRLQRAIN
SI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgattagagttagatttgctccaagcccaaccggatacctccatgttggaggagctaga
actgcgctgttcaactacttgtttgcaaggcactacggtggaaagcttgttctccgtgta
gaggacaccgatatttccagatccaccaaggaatatgaggatcagctaatggagtcgctt
ctgtggcttggtataacatgggatgagggtccagatgtcggtggcgcttttggcccatac
agacaaagtgagagaggccctatttacagggaaatgatcggggatctgctccaaagggga
caggcttatgaagtccatgcctatcctgaagagatagaggaactgcatgacaaattgcta
tcagaagggaaggcgccacactatgatcaagagatgcttgaggccttcaacactgatgaa
agaatctctgagttcgaatccaaagggttgagacctgtcgtttttttcaagatgcctcgg
aaagagtacagacttccagatttgataaagggtgaagtagtctttaaggagggagcaatt
ggagattttgtgattatgcgctccaacggtcaacctatctataacttcgctgtagtggcg
gacgacatcacaatggagatctcgcacgtgatacggggagacgaccacctttccaatact
ctaaggcaacttgcactctatgaagcctttggagctccaataccctcctttgcccatgtt
tcgatgatccttggacctgatggaaagaaactaagtaaaagacatggcgacacttcggtt
gagcagttcagagaaaggggctttttgcctgaggccttcttcaatttccttacactgctt
ggctggtcacacccggacggtaaagagattctgaatcacgaagagattgtagagagtttc
tccattgaaagggtcaacacaagcgctgcaatatttgatgaggcgaaagccaagtggatg
aacggggtttacattcgcgaatctgatcttgaaagaataaccgatttggcagtccccttt
atcattcaatcgaaattgatgactgcagaagatgccgttgccaatagaaaatggctgaaa
agagcagttgattccgttcgaaagggtgtggaaacactctccgaaataccggataagatg
aggctatatttcgaagatcctcaggtgacttttttcactccttccaacgatgttgaaaag
ggtgtttataaagctttggaagctttcaaagaacgagtcgagtatcttgattcatggaac
aacgatgaaataattggtacaataagaggcattctcaaagatctgaaaccggacagaaag
gctttctatatgaccctgagaaaaatactcacatctgtcgaagaggggcccgaattagta
gatattatttttctcctgggaaggaacaagactctcaacaggctccagcgagcaatcaac
tctatatag

DBGET integrated database retrieval system