KEGG   Mesotoga prima: Theba_0515Help
Entry
Theba_0515        CDS       T02123                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpg  Mesotoga prima
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mpg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
562800..563840
Genome map
AA seq 346 aa AA seqDB search
MKLKRLKELCELPGISGFEERVSSYIMEVVKEKVDSVWTDTVGNLIAVRKGNGKSSKRLM
LLAHTDEVGLMVKKINEDGTLSFTNIGGVDPRVLIGKKVLVGENLTPGVIGFEAIHTQDP
SSLLKTPNMNKLKIYLGYSRKEEASEKHRIGDPVSFDTPYKEIGDYAVAKSFDDRTGCEV
LMRVLESLDEKAVDFDVYFAWVVQEEVGLRGSGVAAKQIKPDVALVFENTTAGDNPELPE
YRWATSLGKGPVLTFAHSGLVLDKKILDTIVETAKNNSIEFQYKSRIAGGTDAARLAKVM
AGVPSGVISTPSRYIHSPTSVINVNDFLKVVELATILVKEGKVLSR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaacggttgaaagaactgtgcgaactcccgggaatctccggtttcgaggag
agggtttcttcatatattatggaagttgtcaaagaaaaggtggactctgtctggacagat
acggttggaaatctgatcgctgtcagaaaaggtaatggaaaaagctcaaaacggcttatg
ctcctagcccacacagatgaagttggtctcatggtcaaaaaaattaatgaagatggtacg
ctatcttttactaacatcgggggagtcgatcctcgagtactgattgggaaaaaggtgttg
gttggtgagaatttgacacctggagtcataggatttgaggcaattcatactcaagaccct
tcttctcttttgaaaacccctaacatgaacaagctgaaaatctacttaggctattcaagg
aaggaagaggcttcagaaaaacacagaataggagatccagtttctttcgatactccgtac
aaagagataggggactatgcagtcgcgaagtctttcgacgacagaaccggttgtgaagta
ttgatgagggttcttgaaagccttgacgaaaaagcggtagatttcgatgtttatttcgca
tgggtcgttcaagaagaggtgggtttaagaggaagcggagtcgccgccaaacaaatcaag
cccgatgttgcgcttgtctttgagaatacgacagccggtgataacccagagctgcccgag
tacagatgggccacaagtctaggaaaaggtcccgttttgacttttgctcatagcggtttg
gttcttgacaagaagatccttgacacgattgtcgaaaccgcaaaaaacaattcgatagag
tttcaatataagagcagaatagcgggaggaactgacgcagcaaggcttgcgaaagtaatg
gccggtgtgccttctggagtcatttccacgccttcaagatacattcattcaccaacttct
gtaataaatgtcaacgattttcttaaagtagtagaacttgcaactatactggttaaggaa
gggaaggtgctgtctagatga

DBGET integrated database retrieval system