KEGG   Mesotoga prima: Theba_0516Help
Entry
Theba_0516        CDS       T02123                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpg  Mesotoga prima
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Theba_0516
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Theba_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563837..564847
Genome map
AA seq 336 aa AA seqDB search
MKKLIEKVVTVSSPSGRESAIREAIVEEIKPYVDDMKIDPLGNLIGMKKGSSGKKLLLDG
HMDEIGVVVTHIDSNGFLRVDSVGGLSPYMLLGSRLIFETGASGVVDVEGETAKELGETI
KNLDYDHVFVDIGAIDKKDAENKAPIGTFGTYDSTFVDLGKRIVSKSMDDRIACAIMIQV
LKELDKPKDDVYFVFAVQEEVGIVGASVAAFDIMPDMAVAIDVTAGPDTPKSFKRMGFKL
GGGPTIKIKDRGSVSSARVVSRLKEVAEKKEIPTQYEVLIFGGTDARGYQTTGRGIASGT
VSIPCRYVHSPHEMVDYDDVLNAVRLLKGLAEEGVE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactgatcgaaaaggttgtcactgttagttctccaagcggcagagaatccgct
attagagaagcgatagtcgaagagattaagccttatgttgacgatatgaagatagatcct
ttaggaaatcttattggaatgaaaaaaggaagtagtgggaaaaagcttttgcttgacgga
cacatggatgaaattggggttgtagtcactcacattgactcaaacgggttcttgagagtc
gattcagttggaggactgtctccgtacatgcttctaggttcgagattgatctttgagaca
ggcgcttcgggagtagtggatgttgaaggcgagacggcaaaggaactaggagagactata
aagaacctggactacgatcatgtttttgtagatattggtgcaattgacaagaaggacgca
gagaataaggcaccgattggtactttcggaacctatgattcaacctttgtcgatcttgga
aagagaattgtctccaaatcgatggatgatagaattgcttgcgcaataatgattcaggta
ttgaaagagctcgataaaccaaaagatgacgtatattttgtctttgccgtacaggaggaa
gtcggaattgttggtgccagtgtcgctgcattcgatattatgcccgatatggctgttgcg
atagatgttacagctggccctgacactcccaaatcctttaagagaatgggcttcaaactt
ggaggaggtccaacgataaaaatcaaggatcgaggaagcgtaagttctgcaagggttgtc
tcaagactgaaagaggttgctgaaaagaaggaaattccaactcagtatgaggtactgatt
tttggaggtactgatgcaagaggttatcagacaactgggagaggaatagcatcggggacc
gtctcgattccatgcagatatgtgcactctcctcacgaaatggtcgactatgacgatgtc
ttgaatgcggttcgtcttcttaagggtcttgcagaagaaggagtggaatga

DBGET integrated database retrieval system