KEGG   Mesotoga prima: Theba_0563Help
Entry
Theba_0563        CDS       T02123                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mpg  Mesotoga prima
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(615404..615934)
Genome map
AA seq 176 aa AA seqDB search
MTKDLFLGFGSNMGERLNLIIKAFSMLIERGITLQSVSSLYLTEPLGIIEQNEFLNCVGK
FEFKGDPHFLLEEIKAIERSIGRVERFRWGPREIDIDILLFGEMILTTDKLSIPHKDIIR
RKFVLVPLLEIDEELRDPRDNSLFSDHLESLGKEGWPELFLEAVLFEKLIELEVKR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggatcttttcttaggctttgggagtaacatgggagaaagactgaatctcata
attaaagccttttcaatgctaatagaaaggggaatcacgctgcaatcagtatcatcgctc
tacttgacagaaccattaggcattatcgagcaaaatgaattcttgaactgtgtgggaaaa
ttcgaattcaaaggtgatccacacttcttgcttgaagagattaaggcaatcgagaggtct
attggaagagttgaaaggttcaggtggggtccgcgagaaatcgacatcgatattctgctc
tttggagagatgattctgacaactgataagctttctataccccacaaagatataataaga
aggaaattcgttttggtccctttactcgaaatagacgaagaactcagagacccaagagac
aacagtctcttttcggatcatcttgaaagccttggtaaagagggatggcctgagctcttc
ttagaagcagttctttttgaaaaactaatagaattagaggtgaagagatga

DBGET integrated database retrieval system