KEGG   Mesotoga prima: Theba_0582Help
Entry
Theba_0582        CDS       T02123                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mpg  Mesotoga prima
Pathway
mpg00010  Glycolysis / Gluconeogenesis
mpg00030  Pentose phosphate pathway
mpg00051  Fructose and mannose metabolism
mpg00052  Galactose metabolism
mpg00680  Methane metabolism
mpg01100  Metabolic pathways
mpg01110  Biosynthesis of secondary metabolites
mpg01120  Microbial metabolism in diverse environments
mpg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_0582
   00030 Pentose phosphate pathway
    Theba_0582
   00051 Fructose and mannose metabolism
    Theba_0582
   00052 Galactose metabolism
    Theba_0582
  Energy metabolism
   00680 Methane metabolism
    Theba_0582
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theba_0582
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Theba_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFK06301
UniProt: I2F2Z8
Position
complement(629027..630049)
Genome map
AA seq 340 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRGIVKSAPENVEIIGLMHGWKGLVVGESMKLTDNDVEGIHI
LGGTILGTSRTNPFKSEDMRIKMEENIKKLGLDVIIGIGGDDTLTVAARLSSMGYKAIGV
PKTIDNDVANTDYTFGYQTAVNVGADAIDRLHSTAKSHGRIIIVELMGREAGWVTLEAGM
AAGAHLILIPEYPMTIDEILTYVKKRMDRFGYMIIAVAEGFKPTELENVVGDESKIDAFG
HIKLGGIAHYMANIISERTGYDTRSVVLGHLLRGGTPTAFDRILGTRYGVHAMELVMKGD
FGRMVALKGNDIISIPLEYGIATKKLVPFEYYKLSQIFFD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattggaatattgacgggcggcggggactgtcctggtttgaatgcagttattaga
ggcatcgtgaaatctgctccggaaaacgtggaaattatcggtttgatgcacggttggaag
ggattggttgttggtgagagtatgaaactcaccgataacgatgttgaaggtattcacatt
ctcggaggtacaatccttggaacatctagaacaaatccttttaaatcggaagatatgaga
ataaaaatggaggaaaacatcaagaaactcggtcttgatgtgattataggaatcggaggc
gacgatactttgaccgtggctgcaagactctcatccatgggatacaaagcaattggagtc
ccaaagaccattgacaacgatgttgccaacaccgattatacttttggttatcaaactgcg
gtaaatgttggggcggacgcgattgacagattgcactctactgcaaagtcacatggacgg
atcattatcgttgaattaatggggagagaagctggttgggtgactttggaagctggcatg
gctgccggcgcacatctaatccttattcctgaatacccaatgacaatagatgaaatccta
acctatgtcaagaagcgaatggatagattcggatacatgattatcgcagttgcagagggc
ttcaaaccaactgaattggaaaatgttgttggcgatgaaagcaagatcgacgcctttggt
catataaaactgggagggattgcccattatatggcgaatattatctctgagagaacgggt
tatgatactagatccgttgttctggggcaccttctgagaggtggaacccccacggcattt
gacagaattctgggcacaagatacggagttcacgcaatggagcttgtcatgaaaggcgat
tttggcagaatggttgcacttaaaggcaatgatatcatctctattccccttgaatatgga
atagctacaaagaagttagttccctttgagtattacaaactgtcccagatcttcttcgat
tga

DBGET integrated database retrieval system