KEGG   Mesotoga prima: Theba_0729Help
Entry
Theba_0729        CDS       T02123                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpg  Mesotoga prima
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Theba_0729
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Theba_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775753..776376
Genome map
AA seq 207 aa AA seqDB search
MKGIVFVMSGPSGAGKTSILREVLRSNNNLDFSVSYATRERRPEEVQGKDYFFVTPEEFK
RLQKEDEFLEWAKVHGNYYGTSRHQVSKSVDLGRDILLDVDIQGAMSLMSKLRDAVYIFV
APPSYEELISRLQSRGTEDTQSLRTRLEDAKWELEQVKNFQYLVINDNLKHSVSQFEAII
TAERLRVDRMVREKGERFLFEEKTYDN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtatagtctttgtgatgagcggtccttcaggggccggaaaaacctcgatactc
agagaagtactccgatccaacaataatctcgacttttcagtttcttatgctacgagggaa
agacggcctgaggaagttcagggaaaggattatttttttgtcactccggaggaattcaaa
cgacttcagaaagaagatgagtttttagaatgggcaaaagtccatgggaattattatggg
acctctagacatcaggtcagcaagagcgtagatttgggcagagatattctgcttgatgtg
gacattcagggggccatgtcattaatgagcaaactccgagacgccgtctatatatttgtc
gcaccgccatcttacgaagagctgatcagtcgccttcagtcaaggggaacagaagacact
caatctctaagaacaaggctcgaagatgcaaaatgggaacttgaacaggtgaagaacttt
cagtatctcgttattaatgataatttaaagcattcggtaagtcaatttgaagcaatcatc
accgccgaaaggttgcgtgttgatagaatggtcagagaaaagggagaaagattcttgttt
gaggagaaaacatatgataattaa

DBGET integrated database retrieval system