KEGG   Mesotoga prima: Theba_0762Help
Entry
Theba_0762        CDS       T02123                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpg  Mesotoga prima
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theba_0762
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Theba_0762
Exosome [BR:mpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theba_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807360..808820
Genome map
AA seq 486 aa AA seqDB search
MNYILAIDQGTSSSKAVLFDHELYQVAVAQEEFKQIYPKPGWVEHDPRDIILSTMSTIER
VVSDARISFREIAAIGITNQRETVVAWDALTDQPLYNAIVWQDRRTAGRCKEIESSYGEL
IRRKTGLKPDPYFSATKMEWLLENVPAVRDAANRGRLRFGTIDSWLVWNLTRENLHVCDF
SNASRTMLFNIEELKWDNDLLNLFGVKEEYLPTVVESCKLLGPSIYGPRIGGMAGDQQAS
LFGQTAFQTGDAKCTYGTGSFILMNTGKKPKISEHGLLTTIGWKSKEEIVYAVEGSIFAT
GALISWLKDGLGIIDSPSETESLAREVADNGGVFFSGALTGLGAPYWNSSARGMMIGLTR
GTRKAHIVRAVLEYIAFRTREILDLMEEETGIRLNKLLVDGGVTRNNFLMEMQANVLNIP
VDRSLIKETTALGAAMLAGICTGLWDLESLKNKRISEVVFEPSGDRMEEEFRRWKEALKR
SMNWAN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaactacattcttgctatcgatcagggaacaagtagcagcaaagcggtcctttttgat
catgagctatatcaagttgcggttgcgcaggaggaattcaagcagatctatcctaaaccg
ggatgggtggaacatgatcctagagacattattctcagtactatgagcacaattgagaga
gtggtctcagatgcaagaatttcattcagggagatagcggctataggtatcacaaatcag
agggagacggttgttgcctgggatgctctcacggatcaaccgctttacaatgccatagtc
tggcaagatagaagaactgccggtagatgtaaagagatagaaagctcttatggagagtta
attagacggaagacgggactcaaaccggatccatatttttccgccacaaagatggagtgg
ctgctagagaatgtacctgccgttagagatgcagcaaataggggaagattgagattcgga
acgatagactcgtggctggtatggaatctaacgagggagaatcttcatgtgtgtgatttc
tctaatgcgtctagaacaatgctatttaatatagaagagctgaaatgggataatgatttg
ctcaatctctttggtgtgaaagaggaatatctgccaacagtcgttgagtcctgtaagctc
ctcggcccttcgatatatggtccgaggataggtggaatggctggagatcagcaggcttcg
ctctttgggcaaactgcatttcagactggagacgcaaagtgcacttacggaacgggctcg
ttcattttgatgaacacagggaaaaagccaaagatatctgaacacggtttgctgaccact
ataggatggaagtccaaggaggaaattgtctacgctgttgaagggtcgatatttgctact
ggagctttgataagctggttaaaagacggacttggaataatcgacagtccttccgaaacc
gagtctcttgccagagaagtcgccgataatggtggtgtgttcttttccggagcgcttaca
ggtcttggagcgccctactggaattcttccgccaggggtatgatgatcggtttaactaga
ggaacgaggaaggctcatatagtgagagcggtccttgaatacattgccttcaggacaagg
gaaatactagatttgatggaagaggaaacgggtattagattgaataagctactcgtggat
ggaggggtaacccgaaacaatttcctcatggagatgcaggcaaatgtattgaacattccc
gtcgacagatctctcataaaagagacaacagcgcttggagcggcaatgcttgcaggaata
tgtacaggcttatgggatctcgagagtcttaagaataagagaatcagcgaggtggtgttt
gaaccatcaggtgacagaatggaggaagagttcagaaggtggaaagaggcgctgaagaga
tctatgaattgggcgaattag

DBGET integrated database retrieval system