KEGG   Mesotoga prima: Theba_0816Help
Entry
Theba_0816        CDS       T02123                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mpg  Mesotoga prima
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861161..862006
Genome map
AA seq 281 aa AA seqDB search
MTFENGRVLDLSEPRIMGILNITPDSFFPGSRFLDIPVALDKALEMLENGAAIIDIGGES
SRPGAEKVESKEEIARVLPLIKQLRSKRPDAVISVDTYNSETASAALSEGADMINDITGL
RSMKMIEAVSENHAAVVIMHMRGDPSTMSRMTDYRDVVGEVSSWLFERARRAIDFGVDPD
RIILDPGIGFAKSAEQSIEILKNIEKFKKMGFPVLVGHSRKSFISKITGTPVEERLEETI
SISTYLYRKKVNIIRVHDVQEHGRIFGILKTLNPSGEYWGE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgacattcgaaaacgggagagtgctagatctttcggaaccgcgaataatgggaatactc
aacattacccccgactccttttttccgggaagcagattccttgacataccggttgctctg
gataaagctctcgaaatgctcgaaaatggtgcagcaataatagacataggtggagaatcc
tcaagaccgggagctgaaaaggtagagtcaaaagaggaaatcgcaagggttctaccttta
ataaagcaactgcgaagcaaaagacctgatgcagtgatctcagtagacacttataacagt
gagactgcgagtgctgcactttctgaaggggctgacatgatcaacgatatcaccgggctc
aggtcgatgaagatgatagaggcagtctctgaaaaccatgcagctgttgttattatgcac
atgagaggcgatccttctaccatgagtcgaatgacagattaccgagacgtagttggagaa
gtttcatcctggctatttgaaagggccaggcgggcaatcgatttcggagtagatcctgac
aggataatacttgatcccgggataggtttcgccaagtccgctgaacaaagtattgagatt
ttgaaaaacatagagaagtttaagaagatgggtttccctgttcttgtagggcattccaga
aaaagcttcatatcgaagattactggaacaccggttgaagagagattggaagaaactatt
agcatttcaacatacttataccgtaaaaaggtaaacataattcgcgttcatgatgtacag
gagcacggtcgaatctttggtatacttaagacattgaacccaagcggagagtattggggg
gagtga

DBGET integrated database retrieval system