KEGG   Mesotoga prima: Theba_0936Help
Entry
Theba_0936        CDS       T02123                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpg  Mesotoga prima
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theba_0936
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theba_0936
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theba_0936
Enzymes [BR:mpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theba_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(981732..982988)
Genome map
AA seq 418 aa AA seqDB search
MSKFLLKCITCGKEFSEEEEEYYCPVCGERRGTLEVVYDFDQVREKYESSSVDLNNRGIW
AFDFLLPFENCTDTPRLFVGNTPLYRNHFLEEKYKVSELLLKDDGRNPTASFKDRASGVA
VLKAKEKSFDTVFCASTGNAASSLSGFAAVSGLKSVIFVPATAPAAKITQLQVYGSKILA
INASYDRVFDLSMEIGMSKGWYCRNSAINPYLLEGKKTCAMEIAFKTKDRLPDFVFVSAG
DGTVLSSFYKGFEDLMKLGVISKIPTIVGVQAEGSNAIMRAYERGYPFEPVDIEARTVAD
SISVGKPRDVFKACRYTQKHNGLFLSVSDGEILGSIIELARETGVFAEPAGATAFAGFKK
ARRLSIVNERNSVVIVVTGNGLKDLKSVSYVLPKVETLSPVKDAIEEALNEDQLHTKQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaagtttcttctcaaatgtataacatgcggaaaggagttttcagaagaggaagag
gaatactattgtccagtttgcggcgagcgtagaggaaccctggaagtcgtttacgacttt
gatcaagtgagagaaaaatacgaatcttcttcggtcgatctcaacaacaggggtatttgg
gcatttgattttcttttgccatttgagaattgtaccgatactccaaggctcttcgtaggc
aatactcctctatatagaaaccattttttggaagaaaaatacaaagtatcggagttactc
cttaaagacgacggcaggaatccgactgcttcatttaaagatagagcaagcggtgttgca
gtcttaaaggcgaaagaaaagtctttcgataccgttttctgcgcttcaacgggaaatgca
gccagctcgctttcgggatttgcagctgttagtggactgaagagcgtgatcttcgtcccc
gctacagctcctgccgccaagattactcagctacaggtgtatggatcaaaaatcctggca
ataaatgcgagctacgaccgggtattcgatttgtcgatggaaatcggtatgtcaaagggt
tggtactgtagaaatagcgcaataaatccataccttcttgaggggaagaagacttgtgca
atggaaatcgcattcaagacgaaagacagactaccggattttgtttttgtttcggcaggt
gatggtactgtcttgtcaagtttctacaaagggtttgaagatttgatgaagctcggtgtg
atctctaaaattccaaccatagtaggagttcaggcagaaggttcaaacgcaataatgaga
gcttatgaaagaggatacccatttgagccagtagatatcgaggcaagaacggttgcggac
agcatcagtgtgggaaagccaagagacgtttttaaggcttgcaggtacacacagaagcat
aatggtttgtttctttccgtttcggacggtgagattctcgggagtataattgaacttgcc
agagaaaccggtgtgttcgccgaaccggcaggcgctacggcatttgcaggcttcaagaag
gccagaagattgagtattgtgaacgaaagaaatagtgttgtcatcgtggtaactggaaat
ggtttgaaggaccttaagagcgtttcatatgtgcttccaaaggtcgagactttgtcaccg
gtaaaagatgcaattgaggaggctctaaatgaagatcagcttcacactaaacaatga

DBGET integrated database retrieval system