KEGG   Mesotoga prima: Theba_0964Help
Entry
Theba_0964        CDS       T02123                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
mpg  Mesotoga prima
Pathway
mpg00230  Purine metabolism
mpg00240  Pyrimidine metabolism
mpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Theba_0964
   00240 Pyrimidine metabolism
    Theba_0964
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Theba_0964
    2.7.1.76  2'-deoxyadenosine kinase
     Theba_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_33 AAA_18 AAA_17 TsaE SKI Thymidylate_kin DnaB_C TIP49 ABC_tran AAA_28 Zeta_toxin AAA PRK Cytidylate_kin CoaE AAA_23 Cytidylate_kin2 AAA_29 CPT RsgA_GTPase APS_kinase AAA_22
Motif
Other DBs
NCBI-ProteinID: AFK06670
UniProt: I2F417
Position
complement(1008047..1008652)
Genome map
AA seq 201 aa AA seqDB search
MGRIIVLAGNVGAGKSTIASAIAEGLGFNIHYESVSDNPFLEDFYYDQKRWSYHLQTYFL
YHRYCSLKSAEVNENTVFDRSIYEDKEIFARNLFETGKMSDREFKAYVTMFDSMIKYLKK
PDLLVYIDADVDTILARIRRRGRQMETAVPIAYWEQLDRLYSSWIRDYDLSPIYKIDARS
VDIVINPEKAQQITKEIMRIL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgggaagaataatcgtgcttgccggaaatgttggtgcaggcaagtctactatagcaagc
gccattgctgaaggccttggtttcaatattcactacgaatcggtctccgacaatcccttc
cttgaggatttctattacgatcagaagagatggtcgtatcatctccagacttactttcta
taccacagatactgctccctaaagagtgccgaggtgaatgaaaatacggtatttgatcgt
tcaatatacgaagacaaagagattttcgctcgaaaccttttcgagaccggaaagatgtcc
gacagggaattcaaggcgtatgtgacaatgttcgactcgatgatcaagtatctcaagaag
cctgatctcctggtctatatagatgccgatgttgacaccattctggcgagaataagacgc
aggggaagacaaatggaaactgcggtccctattgcctactgggaacaactcgatagactt
tactccagctggataagagattacgatctttcgccgatttacaagatagatgcgagatcc
gtcgatattgtgatcaatccggagaaggcccagcagatcacgaaggagattatgagaatt
ctatag

DBGET integrated database retrieval system