KEGG   Mesotoga prima: Theba_0983Help
Entry
Theba_0983        CDS       T02123                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpg  Mesotoga prima
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Theba_0983
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Theba_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1029096..1029689)
Genome map
AA seq 197 aa AA seqDB search
MLEGIEGRVREIRETEIVIQVGGLFFKVNCTPNTISKLPVEKDVYLLTFMAYSQDRPPEL
YGFYDQEEKELFNILLRASKIGPKSAMKILSSASPSRIKHIISTKNAAELSSLPGIGKKT
AERMIVELASLVDTSGITDEETIPGVERSHGEEAVAALTSLGFDENQSRKVVIEILKAER
EIDTHDLIKKALKEIRK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaggtattgagggtcgcgtaagagaaataagagagaccgaaattgtcatacag
gtcggaggtctgttttttaaagttaactgcactccgaacacaatcagcaagcttccggtc
gaaaaggacgtttatcttcttacgttcatggcctactcacaggataggccgcctgaactt
tacggcttctacgatcaagaagagaaagagttgttcaatatactgttgagggcaagcaag
ataggacctaagtccgccatgaagattctctcttcggcctctccttcaaggattaagcat
attatttccaccaagaatgcggcagagctgtcttcccttcccggcattggaaagaaaact
gcggaaagaatgatcgttgagctcgcctcgttggtagacacttctggaattacagacgaa
gaaaccattccgggtgttgagaggtcgcacggtgaagaagctgttgcggcacttacatcc
cttggtttcgacgaaaaccagtcgaggaaagtagttatagagattctgaaggctgaaagg
gaaatcgatactcacgatcttataaagaaagcactgaaggagatccgtaagtag

DBGET integrated database retrieval system