KEGG   Mesotoga prima: Theba_1327Help
Entry
Theba_1327        CDS       T02123                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpg  Mesotoga prima
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theba_1327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theba_1327
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theba_1327
Enzymes [BR:mpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theba_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1403023..1404366
Genome map
AA seq 447 aa AA seqDB search
MKKRTVVNLKSEELPRSWYNIKADLPFKMDPPLNPATNEVINPEDMMAIFPKSIVEQEMS
EERFIPIPEPVLDEYAVFRPSPLIRATFLEEYLNTPARIYYKYEGNSPTGSHKTNTAIAQ
AYYNKTDGITELTTETGAGQWGSALSYAGRKFGLTVRVFMVRNSFQSKPMRQHMMRMFDG
TVEPSPGENTESGRNFLKDRKNFSGSLGMAISEAIEIVLNSKTKKYSLGSVLDHVLLHQT
VIGLEVEKQLEMLGEKPSSIIGCHGGGSNFGGTILPFVKRTFNGDDIEFIACEPESCPSL
SKGEYRYDSGDSAGFTPLLKMYTLGREFVPPAIHAGGLRYHGAAPLISRLVKEGIVTPIA
FPQEETFRAGLLFATTEGIIPAPESCHAIAGAVRKAIEARETGEEKVIVFTLSGNGALDL
SSFTSTLEAHRDVLNFDKLRESSIVEQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagaactgtagtgaatttgaagtcagaggagttgccgagaagctggtataac
ataaaggctgatttgccattcaagatggatccgcctttgaatccggcaacaaatgaagtt
ataaaccccgaagatatgatggcgatcttcccaaagtcaatcgtagaacaagagatgagt
gaagagcggttcattccaattcccgaaccggttctcgacgaatatgcggtcttccgcccg
agcccactcatcagagctacctttcttgaggagtacttaaacaccccggcgagaatatat
tacaagtatgaaggaaactccccgactggcagccacaaaaccaatacggctatcgcgcag
gcctattacaacaagaccgatggcatcaccgagctcactaccgagaccggagccggtcag
tggggtagcgccctctcttacgccggaaggaagttcggtctcaccgtaagagtcttcatg
gtcagaaacagctttcagtctaaaccaatgagacaacacatgatgagaatgttcgacggc
accgtggaaccaagtccgggagagaacactgaaagcggaagaaacttcctgaaagacaga
aagaacttctccggctcattgggaatggcaataagtgaggcaattgaaatcgtactcaat
tcaaagacgaagaagtactccttgggaagcgttctcgatcacgttctccttcatcagaca
gtaatcggactggaagtcgagaagcagcttgaaatgcttggggagaagccctcttcgatt
attggttgccacggcggtggatctaactttggcggaacgatcctcccattcgtaaagaga
acatttaacggtgatgatatcgagttcattgcatgcgaaccggaatcctgtccctcactc
tcaaaaggtgagtacaggtacgacagtggagactctgccggtttcacacccctacttaaa
atgtacacgctaggaagagaattcgttccacccgcaattcatgcaggtggactgagatac
cacggcgcagcgcctctcatctcaagactggtgaaagaaggaatcgttactcccattgcc
ttcccgcaggaagagaccttcagggcaggacttctcttcgcaacgaccgaaggaatcatt
cccgctccggaatcatgtcacgcaattgccggtgccgtgcgaaaagcaatcgaagcccga
gaaactggagaggagaaagtaattgtatttacacttagcggaaatggcgcgcttgatttg
tcctcatttacaagcacactcgaggcgcacagagacgttctcaacttcgataagctgcgc
gaatcgagcatcgtagaacagtaa

DBGET integrated database retrieval system