KEGG   Mesotoga prima: Theba_1327Help
Entry
Theba_1327        CDS       T02123                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpg  Mesotoga prima
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theba_1327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theba_1327
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theba_1327
Enzymes [BR:mpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theba_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403023..1404366
Genome map
AA seq 447 aa AA seqDB search
MKKRTVVNLKSEELPRSWYNIKADLPFKMDPPLNPATNEVINPEDMMAIFPKSIVEQEMS
EERFIPIPEPVLDEYAVFRPSPLIRATFLEEYLNTPARIYYKYEGNSPTGSHKTNTAIAQ
AYYNKTDGITELTTETGAGQWGSALSYAGRKFGLTVRVFMVRNSFQSKPMRQHMMRMFDG
TVEPSPGENTESGRNFLKDRKNFSGSLGMAISEAIEIVLNSKTKKYSLGSVLDHVLLHQT
VIGLEVEKQLEMLGEKPSSIIGCHGGGSNFGGTILPFVKRTFNGDDIEFIACEPESCPSL
SKGEYRYDSGDSAGFTPLLKMYTLGREFVPPAIHAGGLRYHGAAPLISRLVKEGIVTPIA
FPQEETFRAGLLFATTEGIIPAPESCHAIAGAVRKAIEARETGEEKVIVFTLSGNGALDL
SSFTSTLEAHRDVLNFDKLRESSIVEQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagaactgtagtgaatttgaagtcagaggagttgccgagaagctggtataac
ataaaggctgatttgccattcaagatggatccgcctttgaatccggcaacaaatgaagtt
ataaaccccgaagatatgatggcgatcttcccaaagtcaatcgtagaacaagagatgagt
gaagagcggttcattccaattcccgaaccggttctcgacgaatatgcggtcttccgcccg
agcccactcatcagagctacctttcttgaggagtacttaaacaccccggcgagaatatat
tacaagtatgaaggaaactccccgactggcagccacaaaaccaatacggctatcgcgcag
gcctattacaacaagaccgatggcatcaccgagctcactaccgagaccggagccggtcag
tggggtagcgccctctcttacgccggaaggaagttcggtctcaccgtaagagtcttcatg
gtcagaaacagctttcagtctaaaccaatgagacaacacatgatgagaatgttcgacggc
accgtggaaccaagtccgggagagaacactgaaagcggaagaaacttcctgaaagacaga
aagaacttctccggctcattgggaatggcaataagtgaggcaattgaaatcgtactcaat
tcaaagacgaagaagtactccttgggaagcgttctcgatcacgttctccttcatcagaca
gtaatcggactggaagtcgagaagcagcttgaaatgcttggggagaagccctcttcgatt
attggttgccacggcggtggatctaactttggcggaacgatcctcccattcgtaaagaga
acatttaacggtgatgatatcgagttcattgcatgcgaaccggaatcctgtccctcactc
tcaaaaggtgagtacaggtacgacagtggagactctgccggtttcacacccctacttaaa
atgtacacgctaggaagagaattcgttccacccgcaattcatgcaggtggactgagatac
cacggcgcagcgcctctcatctcaagactggtgaaagaaggaatcgttactcccattgcc
ttcccgcaggaagagaccttcagggcaggacttctcttcgcaacgaccgaaggaatcatt
cccgctccggaatcatgtcacgcaattgccggtgccgtgcgaaaagcaatcgaagcccga
gaaactggagaggagaaagtaattgtatttacacttagcggaaatggcgcgcttgatttg
tcctcatttacaagcacactcgaggcgcacagagacgttctcaacttcgataagctgcgc
gaatcgagcatcgtagaacagtaa

DBGET integrated database retrieval system