KEGG   Mesotoga prima: Theba_1349Help
Entry
Theba_1349        CDS       T02123                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mpg  Mesotoga prima
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theba_1349
Enzymes [BR:mpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Theba_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1424170..1425300
Genome map
AA seq 376 aa AA seqDB search
MKKRLAILGSTGSIGSQTLQIANRIENIEIVAISCGHNLSLFSKQLSEFHPPFAASLKKS
DSLTDSFPATLFFHGEEGIERMLEESKPDYVLLAVSGAAGLRFSLKAIEVCHRLCLANKE
SIVCGGDLLLKECARKGVELIPVDSEHSGLFQLLDGSRRPKRIIITASGGALRDWPLERI
QDATIRDVLRHPVWSMGNRITIDSASMVNKGLEVIEAKYLFEFETNEIDTYICRNSFIHA
GILYSDGVLKLHTGIPDMRIPIAYSLTYPERIQTIPEQSIVDVPMILEELPKERFPALTL
AREICGVVSKQIAYNAADEVAVEAFMNGRMPFGGIYNIIEKTVERTADQNPVDYSQIIET
DSVARKLAQEEVDRCY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaggctggccattcttggctcaaccggatcgataggatcacaaacactccag
atagcaaatcggattgagaatattgagattgtggccatttcttgtggccacaatctttct
cttttttcgaagcagctttctgaatttcatccgccctttgccgcctcactaaagaaaagc
gatagccttacagattcctttcccgcaacattattcttccacggggaagagggaatcgaa
agaatgcttgaggaatcgaaacccgattatgttttgctggctgtgagcggcgccgcaggt
ctaagattcagcctaaaggccatcgaagtctgtcacaggctttgcctcgccaataaagaa
tctattgtttgtggaggagatcttctcctgaaagagtgtgccagaaagggcgtcgaactg
attcctgtcgactcggagcacagcggcctttttcagctcctcgatggttcacgccgaccg
aaaagaattataataactgcttctggcggggcattaagagattggcccttagaaaggata
caagatgcaacgataagagatgttttgaggcatcccgtctggtcaatgggaaacaggata
acgatcgacagtgcctccatggtcaacaagggacttgaagtgattgaagccaaatacctc
tttgaatttgaaactaatgaaattgacacatacatatgcagaaacagttttattcatgct
ggtatcctttatagcgatggtgtcttgaagttacacactggcataccagacatgaggatc
ccgatcgcctactcgcttacatatcctgaaagaattcaaaccattcccgagcaaagtatt
gtcgatgtccccatgattcttgaagagttaccaaaagagaggttccctgctctaacgctt
gcgagagagatctgtggagtagtaagtaaacagattgcctataatgctgcagacgaagtt
gccgtcgaagcttttatgaatggccggatgccttttggaggtatttacaatataattgaa
aagacagtagaaagaaccgctgatcaaaatccggtcgactacagtcaaataatcgagact
gacagcgttgcaagaaagttagctcaggaagaggtggatagatgttattag

DBGET integrated database retrieval system