KEGG   Mesotoga prima: Theba_1369Help
Entry
Theba_1369        CDS       T02123                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mpg  Mesotoga prima
Pathway
mpg00480  Glutathione metabolism
mpg00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Theba_1369
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Theba_1369
Enzymes [BR:mpg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Theba_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Poly_export
Motif
Other DBs
NCBI-ProteinID: AFK07057
UniProt: I2F554
Position
complement(1448093..1448572)
Genome map
AA seq 159 aa AA seqDB search
MSIYDFELTTIDGWNKSMEDFKGKVVLLVNTASKCGYTPQYEGLQQLYEEFKEKDFVVLG
FPSNDFLRQEPGSDEEIKTFCSTNFNITFPMFSKIHVKGKNIHPLYEYLTSGGGKKEFSG
KVKWNFTKFLIDRNGEIIGRFEPKEEPETFRSAIEEAVR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatatgactttgaactgactactattgacggttggaacaagtctatggaagac
ttcaaaggtaaggttgttctgctggtaaatactgcgagtaaatgtggatatacacctcag
tatgaaggcctgcaacagctttatgaagaattcaaggaaaaggactttgtcgttttgggt
ttcccctctaacgattttcttcgtcaggagcccgggagtgatgaagagataaagacgttt
tgcagcactaacttcaatatcacctttcccatgttttccaagattcatgtaaagggaaag
aacattcatccactttatgagtacctgacaagtggcggaggaaaaaaggagttttcggga
aaagtgaagtggaacttcacgaagtttttaatagatagaaatggtgagattattggaagg
ttcgaaccaaaagaggaaccggagacatttcgctctgcaatcgaggaggcggtaaggtga

DBGET integrated database retrieval system