KEGG   Mesotoga prima: Theba_1369Help
Entry
Theba_1369        CDS       T02123                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mpg  Mesotoga prima
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Theba_1369
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Theba_1369
Enzymes [BR:mpg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Theba_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1448093..1448572)
Genome map
AA seq 159 aa AA seqDB search
MSIYDFELTTIDGWNKSMEDFKGKVVLLVNTASKCGYTPQYEGLQQLYEEFKEKDFVVLG
FPSNDFLRQEPGSDEEIKTFCSTNFNITFPMFSKIHVKGKNIHPLYEYLTSGGGKKEFSG
KVKWNFTKFLIDRNGEIIGRFEPKEEPETFRSAIEEAVR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatatgactttgaactgactactattgacggttggaacaagtctatggaagac
ttcaaaggtaaggttgttctgctggtaaatactgcgagtaaatgtggatatacacctcag
tatgaaggcctgcaacagctttatgaagaattcaaggaaaaggactttgtcgttttgggt
ttcccctctaacgattttcttcgtcaggagcccgggagtgatgaagagataaagacgttt
tgcagcactaacttcaatatcacctttcccatgttttccaagattcatgtaaagggaaag
aacattcatccactttatgagtacctgacaagtggcggaggaaaaaaggagttttcggga
aaagtgaagtggaacttcacgaagtttttaatagatagaaatggtgagattattggaagg
ttcgaaccaaaagaggaaccggagacatttcgctctgcaatcgaggaggcggtaaggtga

DBGET integrated database retrieval system