KEGG   Mesotoga prima: Theba_1434Help
Entry
Theba_1434        CDS       T02123                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mpg  Mesotoga prima
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theba_1434
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_1434
   00052 Galactose metabolism
    Theba_1434
   00500 Starch and sucrose metabolism
    Theba_1434
   00520 Amino sugar and nucleotide sugar metabolism
    Theba_1434
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theba_1434
   00524 Butirosin and neomycin biosynthesis
    Theba_1434
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theba_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1521466..1522395
Genome map
AA seq 309 aa AA seqDB search
MELIEERTLLGIDVGGTKTAVVLGDEALNILARAEFPTEPELGFQSFIKRLSSEIIGLTG
DLIPSRVGISVGGPMDCKTGTLFNPPHLRWGTVNIVQPLVERFGFSITIEHDGRAGALAE
GILGAGRGFLNIVFLTLGTGLGAGIIINGNIYSGSTGLAGEVGHMRVAVDGPSLYGKNGS
WESFCGGTGISLYAHYRFPERFKRGTTTQDISHLALKKDPNAITVLEESGAYFGKGLAVL
LDILDPDRIILGNLAWRLPKIWLEAALKMAAEEALIGDEARNRVVITELKDRIGDYAALI
VASGMGRRR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagttgattgaagaaagaaccctccttggcatagatgtgggaggtacgaaaacggcc
gtcgttctgggagatgaagctctcaacatcctcgcaagagcagagttcccgaccgaacca
gagctcggttttcagagcttcatcaagaggctctcttcagaaatcatcggtcttacagga
gatttgattccatccagggtgggaatatccgtcggaggtcctatggattgtaaaacgggt
actttgttcaaccctcctcaccttcgatggggaaccgttaacatagttcagccgttggtg
gagcgttttggtttctcgataacgatcgaacacgacggaagagccggtgcacttgccgaa
ggcattctgggggccggcaggggctttctaaacattgtctttctgactctgggaaccggc
ctgggcgcaggcataattatcaatgggaatatttatagtggatctacgggattggctgga
gaggttggtcatatgagagtagccgtggatggtccgtcgctctacggaaagaacggttca
tgggagtctttttgtggtggtacgggaatttcactatatgcgcattacagatttcctgaa
cggtttaagcggggaacgactactcaggatatttcacaccttgcactgaagaaggatcct
aacgccatcaccgtccttgaggaaagcggagcatacttcgggaaaggtctcgccgtgctg
ctggatattctcgaccctgacaggataattctcggtaaccttgcctggcgccttccgaaa
atctggcttgaggctgctctaaagatggcagcggaggaagcgcttatcggcgatgaggcg
agaaatcgggtcgttattacggagctcaaagacaggattggtgactatgccgctttgatt
gtggcaagcggaatgggaagaaggagatag

DBGET integrated database retrieval system