KEGG   Mesotoga prima: Theba_1485Help
Entry
Theba_1485        CDS       T02123                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mpg  Mesotoga prima
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Theba_1485
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Theba_1485
Enzymes [BR:mpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Theba_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1578441..1579937
Genome map
AA seq 498 aa AA seqDB search
MRLSQVIELLGNSVLQVVNPGNVDPEFDHIESDSRGLKERNLFICIKGTNFDSHLIAREL
QRKGAVALVAEMPIEDEEVVVPIVYVKSSRLVEALLTMEEYCHPYRKLTTIGVTGTNGKT
TITTLIYHVLSSFERKASLIGTVRNVVGENIYTNPKNTTPGPVELAKLLQLSTKLKSEYF
IMEVSSHSLSMNRVEGMRFDVGIISNVTRDHLDFHPTFDDYYRSKMKLFSLLKTNGIAVV
NGDKINIADIHISRNRITTYGFGDESDYRIENLDISRTGMDFTIQTPYGSSHRIYSRLIG
EHNAYNIAAAVAALNSLNYDLDHIAKAISSFGGVPGRFEFVEEATKYGFDVVVDFAHTPD
ALEKLLKTARRLTPGRLILVFGAGGSADKGKRPLMSEVSSKYSDVVILTSDDPKLDDPAE
ILQDLESGVDKFKPYLVIPDRREAISVALTLANRQDMVLIAGRGHEDFQILGEKRIPFND
KQVVKDILESKFRRHIKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggttatctcaggtcatagaactcctcggcaacagtgttcttcaggtggtgaatccc
ggaaatgtcgatcctgaattcgatcatattgagagtgattccaggggtctaaaggagaga
aacctctttatatgcattaagggtacaaatttcgattcacacctaattgcgagggaactt
caaagaaagggagcagtcgctttggtcgcggaaatgcccattgaagacgaggaagtggta
gttcctatcgtttacgtcaaaagttctcgtctagtagaggcattgcttaccatggaggaa
tactgtcatccctacaggaagcttaccactatcggtgtaacaggcacaaacgggaagact
acgatcacaactcttatctatcatgttttatcatcatttgagaggaaggcatctcttatc
ggtaccgtgagaaatgttgtgggagaaaacatatataccaatcctaagaacaccacgccc
ggaccggtcgagcttgcaaagcttcttcaactttctacgaaactgaaaagcgagtacttc
attatggaagtctcgtcacattctctctcgatgaacagggttgagggaatgaggttcgat
gtaggaataatcagcaacgtcaccagagaccatctggactttcaccctaccttcgatgac
tattacagatcgaagatgaaactcttctctttattgaagaccaacggaatagctgttgta
aatggtgacaagataaatatcgcggatatccacatttctagaaacagaatcacgacctat
ggttttggcgatgaatcggattacagaatcgagaatctcgatatctcaagaacgggcatg
gatttcactatacaaacgccgtacgggtcttcacataggatctactctagattgatcgga
gaacacaacgcttacaatatagcagcagctgttgccgcactcaattcactgaattacgac
ctggaccacatagccaaagctatctcatccttcggaggtgttccgggtagattcgagttt
gttgaagaggctacgaagtacggctttgacgtagttgtagacttcgcccatactccagat
gcgttggaaaaacttttgaagacggcaagaagactcactccaggcaggttgattctggtt
tttggcgcaggaggatctgccgataagggaaaacgtcctttgatgtctgaagtctcttca
aaatacagcgatgtagttattctcacttccgatgatccaaagctggacgatcccgcagag
atccttcaggatctcgagagcggcgtcgataaattcaaaccttatctcgttattcctgac
agaagagaggcaatatcagttgcccttacgcttgccaatcgtcaggacatggtcttgata
gctgggcgaggccatgaggatttccaaatccttggcgaaaagagaattccctttaatgat
aaacaggtagtaaaggatattctggagagcaagttccggaggcatataaaaaagtga

DBGET integrated database retrieval system