KEGG   Mesotoga prima: Theba_1745Help
Entry
Theba_1745        CDS       T02123                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mpg  Mesotoga prima
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theba_1745
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Theba_1745
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Theba_1745
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Theba_1745
Exosome [BR:mpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theba_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1889301..1890704
Genome map
AA seq 467 aa AA seqDB search
MKKALLLFSLVVLFALTALAGPKYVFLFIGDGMALPQINAAQLFLSSSFEDAVTPKLNML
RFPVQGMTTTYSSNSFITDSASAGTAIATGRKTNDGVISMDPTLTESYQTVAEFAKSRDM
KVGIISSVSIDHATPAVFYAHEKSRNNYYSIGLQAVTSNYDLFGGGTFNRPDNKGKDRNL
FEIAVENGFTVVRTQEEFESLESVEGKVIITNEVIPGSGAMAYEIDRENEFSLADITAKA
IQLLSNDNGFFIMVESGKIDWACHANDAAASVGDTIAFDKAIAEAIKFYNEHPEDTLIVV
TGDHETGGLTLGFAGTKYVANVPTIGNQKMSYEAFDALLSSEKALGKLNTFEDLLVLVED
NFGLVTTGKPQGIPLNDTEIERLREAFGYYVNGSVPKDSRTYILYGGYNPVSVTLTHILN
EKAGLGWTSYSHTGVPVATFAMGVGQEMFAGFYDNTDIGKNLFKLLD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcactgctacttttctcgcttgtggttctatttgcgttaacggctcttgcg
ggtccaaagtatgttttcctgtttattggcgatggcatggctcttccacagatcaacgca
gcacaactatttctaagttcatcatttgaggatgcggtaactcctaagctaaacatgctt
aggtttccagtccagggtatgacgacaacctactcctcaaactccttcataaccgactca
gcctcggccggtactgcgatagcaacaggaaggaagacgaatgatggcgttattagcatg
gatccaacacttactgaatcctaccaaacggttgcagaatttgccaaaagcagggacatg
aaagtcgggatcatttcaagcgtctccatcgaccatgccacgccggcagttttttacgct
catgagaaatcaagaaacaattactactcaattgggcttcaggcagtaacaagtaattac
gacctcttcggtggcggaactttcaacaggcctgacaacaaaggtaaagacagaaatctc
tttgagatagctgtagaaaatggattcacggttgtaagaactcaggaagagttcgaatca
cttgaatcagttgaaggaaaggtcattatcacaaacgaagtaattcctggcagcggagcg
atggcttacgaaatcgatagagagaacgaattctctctggcagatattactgcaaaagca
atacaacttctctcaaatgacaatggcttcttcataatggtcgagtcaggcaagatagac
tgggcgtgtcacgcaaacgacgcagcagcatcagttggagatacgatagctttcgataag
gcaatagcggaagcaataaagttctacaatgaacatccggaagatacccttattgttgtt
accggtgatcacgaaacgggaggactcacactaggttttgctggaacaaagtacgttgcc
aacgttccaacaatcggaaatcagaagatgtcctacgaggccttcgatgctctcctctct
tctgaaaaggctctgggcaaactcaacacgttcgaagatcttctcgttcttgttgaggac
aactttggtcttgtgaccactggcaaacctcagggcatccctctaaacgatacagagatt
gaaagacttcgggaagccttcggttactacgtgaatggtagcgtaccaaaggatagcaga
acatacatcctctacggtggttacaatccagttagcgtaacactcactcatattctgaat
gaaaaagccggactcggttggacatcttactcgcataccggtgttccagttgcaacattc
gccatgggtgttggccaagaaatgttcgcaggtttctacgacaataccgatatcggcaag
aatctcttcaaactcctagactaa

DBGET integrated database retrieval system