KEGG   Mesotoga prima: Theba_1788Help
Entry
Theba_1788        CDS       T02123                                 

Definition
L-fucose isomerase family protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
mpg  Mesotoga prima
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1935480..1936898)
Genome map
AA seq 472 aa AA seqDB search
MKKRKVGVITFSDGRDFVHNDLIEMNKGFQDRLVKALEATGEVEVVTASDIVWKPSLAKK
AGKELMKAEVEATIFNYAIWCWPHLSVMASLYAPGPFLTYGQINPSYPGMVGQLAAAGAL
EQVGIMPERVWGNPEDSDVIERVMHFVRAASAAARLKGERYGMFGGRPMGMYTASANGDQ
WLKEFGVDVEQIDQYELVVRAEKVPKDVTKAAREWLEKLATVKYDGKQLTPEKLEKQIAL
YEAALSIIKEYELDFVGFKGQPEMTNNYATMDIVEAFLNDPYDWHGSKETIVAATETDMD
GALTMEIFKHIAQSPVLFADVRHYFEEEDLLDLCNSGTHATYFAGKSMNPEDNLKHVELY
PEDFYFPAGGAAVKHFAAPGRVTLARLARQNGEYIMTIVPGEFVKLSEAEEKKLSEKVQI
EWPHAYVKLDTDMDTFLRYYPCNHTHGVYGDFVEELVQFCDIKGIDYQILGE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagaaaggttggagtgatcactttttccgacgggcgcgatttcgttcacaac
gatctgatcgaaatgaacaaggggtttcaagacaggctggttaaggcccttgaagcaacg
ggtgaagtggaagttgtcacagcctccgatatagtctggaagccttctctcgcgaagaag
gccggcaaggagctgatgaaggccgaggttgaggccacgatattcaactatgctatctgg
tgctggccgcatctttccgtgatggcctcgctttatgcaccaggtcctttcctcacctat
ggacagatcaatccctcttaccccggtatggtaggccagctggcggcagcaggtgccctc
gaacaggtcggaataatgcctgaaagggtatggggcaatcccgaagattcagatgtaatt
gaaagggtaatgcacttcgtgagggctgcttcagcggccgcaagactgaagggtgaaaga
tacggtatgttcggcggccgtccgatgggaatgtacacggcttcggccaacggtgatcag
tggctgaaggagttcggtgtcgatgtggaacagatcgaccagtatgaactggtagtcagg
gcagagaaagtaccaaaagacgtcacaaaagcagctagagagtggcttgaaaagcttgca
actgtaaagtatgacggcaaacagcttacacctgaaaaactggagaagcagatcgcgctc
tacgaggccgcgctcagtatcataaaagagtacgagctggattttgttggattcaaaggt
cagcccgagatgacaaacaactacgcaacgatggacatagtagaggccttcctcaatgat
ccgtatgactggcacggttcaaaggagacaatcgttgcggccaccgaaacggacatggat
ggagctctgaccatggagatcttcaagcatattgctcagtctccagttctatttgctgac
gtgagacactacttcgaggaagaggaccttctcgacctctgtaactcgggcactcatgcg
acctactttgccggaaaatctatgaatcccgaagacaatctcaaacacgtagaactgtat
cccgaggacttctacttcccggccggaggagctgccgtaaagcattttgcggcacctggg
cgagttacccttgccaggcttgcgagacagaacggcgagtacatcatgacaatagtaccg
ggagagttcgttaagctctccgaagcagaagaaaagaagctgtcggagaaggttcagatc
gaatggccacatgcctacgtgaagctggatacggacatggataccttcctgagatactac
ccgtgcaaccacactcacggtgtttatggcgattttgtagaggaattggtacagttctgt
gatataaagggtattgattaccagattcttggagagtaa

DBGET integrated database retrieval system