KEGG   Mesotoga prima: Theba_1812Help
Entry
Theba_1812        CDS       T02123                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mpg  Mesotoga prima
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Theba_1812
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Theba_1812
    3.5.1.-  
     Theba_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1956311..1956919)
Genome map
AA seq 202 aa AA seqDB search
MRKALLVVDVQNDFYETGALPVNDASKINTVVNRTMKDPVYKVIVASQDWHPSNHMSFAV
NHGKDPFTPFDNGKGIGPVLWPVHCQQGSHGAEFHQDIESWRFDYIVRKGTHPHVDSYSI
FKENDGTQLGTDGLLKALGTEELDICGLALDYCLKYTVHDALLAGFKINVIINGTKGVEA
NQGDIQRTIEEFKSAGVKLIER
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagcactgctagtcgtagatgttcagaacgacttctatgaaaccggcgcactg
cccgtaaacgatgcgagcaagatcaacacagtggtaaacagaacaatgaaagaccccgtg
tacaaggtgatagttgcgagccaggactggcatccgtcgaatcacatgagctttgcggtc
aatcatgggaaagacccttttacaccgtttgacaacggaaaagggatcggccccgttttg
tggcctgttcactgtcaacagggaagtcatggagcggagtttcatcaagacatagagagt
tggcgcttcgactatatagtaagaaaggggactcacccccacgtcgacagctactcgatc
ttcaaggagaacgatggaacacagcttggaaccgacggacttctcaaggcacttggaacc
gaggaacttgacatttgcgggctcgctcttgactactgcctaaaatatactgttcacgat
gcgctcctggcaggcttcaagataaacgtaataataaacggaacaaaaggggttgaggct
aaccagggcgatattcagaggactatagaggagttcaaaagcgcgggagtaaaacttatc
gagagatga

DBGET integrated database retrieval system