KEGG   Mesotoga prima: Theba_1818Help
Entry
Theba_1818        CDS       T02123                                 

Definition
(RefSeq) phosphoglycerate mutase, BPG-dependent, family 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpg  Mesotoga prima
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theba_1818
   01230 Biosynthesis of amino acids
    Theba_1818
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_1818
  Energy metabolism
   00680 Methane metabolism
    Theba_1818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theba_1818
Enzymes [BR:mpg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Theba_1818
Exosome [BR:mpg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Theba_1818
  Exosomal proteins of melanoma cells
   Theba_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962497..1963243)
Genome map
AA seq 248 aa AA seqDB search
MTKLVLVRHGESTWNKENRFTGWTDVDLSEKGREEAENAGKVLKADGYDFDLAYTSVLKR
AIRTLWYIMDEMDLMWIPVIKDWRLNERHYGALQGLNKAETAAKHGEEQVKIWRRSYDIR
PPALEESDERFPGHDPKYRSLSDEELPRTECLKDTVARFLPLWKNEISTQIKSGKKVLIV
AHGNSLRALVKYLDNIPDEEIVGLNIPTGIPLVYELDDGLKPIKHYYLGDPEEIAKAQQA
VANQGKAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcgtactggtaagacacggagaaagcacatggaacaaagagaaccgtttc
actggctggaccgatgttgatctctccgaaaagggaagagaggaagcagagaatgcgggg
aaggtgctgaaggccgatggatacgatttcgatcttgcctacacttcagttctgaagagg
gcaataagaaccctttggtacataatggacgaaatggatctcatgtggattccggtgatc
aaggactggagactgaacgagagacactatggagccctccagggccttaacaaagctgag
accgccgcaaaacatggcgaagaacaggtgaagatctggaggaggagctacgatattcgg
ccgcctgcgctcgaagagagtgacgagagatttccaggtcacgacccgaaatacaggtct
ctttcagatgaggaactccccagaaccgaatgtcttaaggacacagtggcaagattcctg
ccactttggaaaaatgagatatccacacagataaagtctggaaagaaagtgctgatagta
gcccacggaaatagccttagggcacttgtcaagtatctggacaatatcccagacgaggag
atcgtaggattgaacattccgaccggaatacctctagtctatgaactggatgacggtcta
aaaccaataaagcactattatctgggcgaccccgaagagattgcaaaggcacaacaggcc
gtcgctaatcaggggaaagcaaagtga

DBGET integrated database retrieval system