KEGG   Mesotoga prima: Theba_1887Help
Entry
Theba_1887        CDS       T02123                                 

Definition
(GenBank) hexose kinase, 1-phosphofructokinase family
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mpg  Mesotoga prima
Pathway
mpg00010  Glycolysis / Gluconeogenesis
mpg00030  Pentose phosphate pathway
mpg00051  Fructose and mannose metabolism
mpg00052  Galactose metabolism
mpg00680  Methane metabolism
mpg01100  Metabolic pathways
mpg01110  Biosynthesis of secondary metabolites
mpg01120  Microbial metabolism in diverse environments
mpg01130  Biosynthesis of antibiotics
mpg01200  Carbon metabolism
mpg01230  Biosynthesis of amino acids
Module
mpg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mpg_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_1887
   00030 Pentose phosphate pathway
    Theba_1887
   00051 Fructose and mannose metabolism
    Theba_1887
   00052 Galactose metabolism
    Theba_1887
  Energy metabolism
   00680 Methane metabolism
    Theba_1887
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theba_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AFK07535
UniProt: I2F6I2
Position
complement(2028003..2028932)
Genome map
AA seq 309 aa AA seqDB search
MVIFSLTLNAALDRFLYTDALIEDDTVRVDRVKDYPAGKGVDVSRVINELGGHSVAVAFL
GGHTGKVIEEMLDDEGVVYATVRSEEETRTNILVQTGSGQYRMSLPGPVISVKEVYKLYK
TIDVLLRKDDYLLLCGSIPEGVSSDIYAQLCSRMRKIGVNVYIDSDKEPFSKGVEAKPRG
IKPNIHELQRLLNRELIGEIDFRKAISEVSNKYSIEEILLTMGAEGAIASVSGEFYRIRV
PKVPVKSGVGAGDSFLAAYCMYRELGETVKTALKMAGAASSAAVMTPGTELCRFDDVMSL
ASKIAVEAL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgattttctcactgactttgaacgcagctctagatagattcttatatacagacgct
ctaattgaggacgatacggtgagggtagatagagtcaaagattaccccgcaggaaagggt
gtagacgtatcacgtgtgataaatgaactgggaggccattcggtcgctgtagctttcctt
ggaggtcataccggaaaggtaatagaagagatgctcgacgatgagggagtcgtttatgca
acggtaagaagtgaagaagaaacaaggaccaacattctcgtacagactggaagcggtcaa
tacagaatgagtcttcccggtccggtaatatccgtcaaggaagtctataaactgtacaag
acaatcgacgtacttttgagaaaggacgactaccttcttttgtgcggaagcataccggaa
ggagtaagcagcgatatctacgctcagctttgttcaaggatgaggaaaattggagtcaac
gtttatatcgattccgacaaggagcctttctccaagggggtcgaggccaagccaagagga
ataaagccaaatattcacgaacttcagagactgctcaatcgcgagctaatcggagagata
gattttagaaaggccatttccgaagtgtcgaacaagtattcaatcgaagaaattctactg
actatgggagccgagggagcgattgcatcagtgagtggggagttctatcgtattcgggta
cctaaagtacctgtcaagagcggggttggtgcaggggattctttcctggcggcatactgc
atgtacagagaacttggcgagacggtgaaaactgccttgaaaatggctggtgccgccagt
tcagctgccgtcatgacacccggcacagagctttgtagattcgatgatgtaatgagtctt
gcttcgaagatagctgtagaagcgctgtaa

DBGET integrated database retrieval system