KEGG   Mesotoga prima: Theba_2099Help
Entry
Theba_2099        CDS       T02123                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mpg  Mesotoga prima
Pathway
mpg00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Theba_2099
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Theba_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AFK07733
UniProt: I2F730
Position
complement(2241299..2242243)
Genome map
AA seq 314 aa AA seqDB search
MIDYAFNGEILCMGSMNMDLVMVMDRLPEPGETVLTDNFSTYPGGKGGNQAVAAAISGAR
VQMFTKLGGDGFSEELIQMMKEKGVDTSRILRDPESTAGIAMIRVDKNGQNSISFTPGSN
ARLSPEDVEKNSDLFKRGRILLLTMEIAQETIFRAIKLAHENGMFTIVDPAPAPRNGFPD
SIAPLINLIKPNESEARILTGIDVHDRESARIALQRLSSMGFNLPIITLGEKGVVGVDGN
DFMDLKPFDVHCVDTTAAGDVFSGALAAALSKGMHLKESLEWANAAGALSTTISGAQTSI
PAPKSVEKLLRRQV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgattgattacgcatttaacggagagattctctgcatgggaagcatgaacatggatcta
gtgatggtaatggatagacttcctgagcctggagagactgttctcacagacaacttcagt
acctacccgggaggaaagggaggaaatcaagcagttgcggcggcaatcagtggcgcgaga
gttcagatgtttacgaaacttggtggtgacggattcagtgaagaactgatccagatgatg
aaggaaaaaggggtagacacttccagaatacttagggatcccgaaagcacagcgggtatt
gcaatgataagagttgacaaaaatgggcaaaactcgatttcttttaccccgggtagtaat
gcgcggctttctcctgaagacgtggagaaaaactctgatctcttcaaacgcgggcgtatt
cttttgctaacaatggaaatagcacaggagacaatcttcagggcaatcaaactggcccat
gaaaatggaatgtttacgatagtcgatcccgcgcctgctcctagaaatgggttccccgat
tccatcgcgcctttgatcaatttaataaagcctaatgaatccgaagcgaggattctgaca
ggcatagatgtccacgacagagaatctgcgcggattgccctccaaagactaagttcaatg
ggcttcaatctaccaataattactcttggcgaaaaaggcgttgttggagttgatggcaat
gacttcatggacttgaagccctttgacgttcactgtgtggacacaactgcggctggagat
gtcttttcaggggctttggcagctgctttatcgaagggtatgcatctgaaggaatctcta
gagtgggcaaatgcagcaggagcattgagcactacaatctccggtgctcaaacttctatc
cctgctccgaaaagcgtcgagaagttactaagaaggcaggtgtaa

DBGET integrated database retrieval system