KEGG   Mesotoga prima: Theba_2216Help
Entry
Theba_2216        CDS       T02123                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpg  Mesotoga prima
Pathway
mpg00010  Glycolysis / Gluconeogenesis
mpg00030  Pentose phosphate pathway
mpg00051  Fructose and mannose metabolism
mpg00052  Galactose metabolism
mpg00680  Methane metabolism
mpg01100  Metabolic pathways
mpg01110  Biosynthesis of secondary metabolites
mpg01120  Microbial metabolism in diverse environments
mpg01130  Biosynthesis of antibiotics
mpg01200  Carbon metabolism
mpg01230  Biosynthesis of amino acids
mpg03018  RNA degradation
Module
mpg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mpg_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_2216
   00030 Pentose phosphate pathway
    Theba_2216
   00051 Fructose and mannose metabolism
    Theba_2216
   00052 Galactose metabolism
    Theba_2216
  Energy metabolism
   00680 Methane metabolism
    Theba_2216
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Theba_2216
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theba_2216
Protein phosphatases and associated proteins [BR:mpg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Theba_2216
Messenger RNA biogenesis [BR:mpg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Theba_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 LYTB DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFK07847
UniProt: I2F7E4
Position
2364180..2365142
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRATVRTAYTDEIAVVGIRRGYSGLLDEEFIDMDYSSVGG
IMEKGGTVLRSSRCEEFRTEEGRTKAADLLRSNGIDALVVIGGEGSLNGAKLLMDENGIP
VIGLPGTIDNDIAMTDMCIGVDTCLNTCVETIQKLKDTASSHERAFVVEVMGRNSGYVAL
ASGMAVGAEAIIVPELPVDYEAIAEKIWNERKRGKINCIIVVAEGAASAYTVARHVEHRI
GYETRITILGHIQRGGSPTAFDRVLASRMGYASVKALEEGKAGMMMSLNGGKIKGIPLEE
VLSHKKELDMELMEMAKILS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaagattggtgtccttacgagcgggggagattcaccgggaatgaacgcggcg
ataagagcgacggtaagaacggcttacacggatgagatagctgtcgttggaattcgcaga
ggatactccggtctgctcgatgaggaattcatcgatatggattactcctctgtgggagga
ataatggagaagggcggcacagtacttcgcagctcacgctgtgaggagttcagaaccgaa
gagggaaggacaaaagcggccgaccttttgagaagcaatgggattgatgcacttgtagtt
attggtggagaaggaagcttaaacggagccaagcttctcatggatgaaaacggaattccc
gtaataggtcttcccggaacgattgacaatgatattgccatgacggatatgtgtatcggt
gtcgatacctgtttgaatacctgcgtagaaacgattcagaagctcaaggacacggcttct
tcacatgaaagggcctttgttgtagaagttatgggaagaaactctggatatgtagcgctt
gcttccggtatggccgttggagctgaagccattatagttccagagcttccagtggactac
gaagcgattgccgagaagatatggaatgaaaggaaaaggggaaagatcaactgtattata
gttgtcgctgaaggggctgcaagcgcatatacagttgcaagacatgttgaacacaggatt
ggatacgaaacaagaataaccattctcggccacattcaaaggggaggctctcccactgca
tttgatagagtacttgcttcaagaatgggatatgcgtcggttaaggcgcttgaagaaggt
aaagcgggaatgatgatgtcgttgaatggtgggaaaatcaaaggaatacctcttgaggaa
gtgctttcacacaaaaaagaactggatatggaactgatggaaatggcgaaaatactctct
taa

DBGET integrated database retrieval system