KEGG   Mesotoga prima: Theba_2216Help
Entry
Theba_2216        CDS       T02123                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpg  Mesotoga prima
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theba_2216
   01230 Biosynthesis of amino acids
    Theba_2216
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_2216
   00030 Pentose phosphate pathway
    Theba_2216
   00051 Fructose and mannose metabolism
    Theba_2216
   00052 Galactose metabolism
    Theba_2216
  Energy metabolism
   00680 Methane metabolism
    Theba_2216
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theba_2216
Protein phosphatases and associated proteins [BR:mpg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Theba_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2364180..2365142
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRATVRTAYTDEIAVVGIRRGYSGLLDEEFIDMDYSSVGG
IMEKGGTVLRSSRCEEFRTEEGRTKAADLLRSNGIDALVVIGGEGSLNGAKLLMDENGIP
VIGLPGTIDNDIAMTDMCIGVDTCLNTCVETIQKLKDTASSHERAFVVEVMGRNSGYVAL
ASGMAVGAEAIIVPELPVDYEAIAEKIWNERKRGKINCIIVVAEGAASAYTVARHVEHRI
GYETRITILGHIQRGGSPTAFDRVLASRMGYASVKALEEGKAGMMMSLNGGKIKGIPLEE
VLSHKKELDMELMEMAKILS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaagattggtgtccttacgagcgggggagattcaccgggaatgaacgcggcg
ataagagcgacggtaagaacggcttacacggatgagatagctgtcgttggaattcgcaga
ggatactccggtctgctcgatgaggaattcatcgatatggattactcctctgtgggagga
ataatggagaagggcggcacagtacttcgcagctcacgctgtgaggagttcagaaccgaa
gagggaaggacaaaagcggccgaccttttgagaagcaatgggattgatgcacttgtagtt
attggtggagaaggaagcttaaacggagccaagcttctcatggatgaaaacggaattccc
gtaataggtcttcccggaacgattgacaatgatattgccatgacggatatgtgtatcggt
gtcgatacctgtttgaatacctgcgtagaaacgattcagaagctcaaggacacggcttct
tcacatgaaagggcctttgttgtagaagttatgggaagaaactctggatatgtagcgctt
gcttccggtatggccgttggagctgaagccattatagttccagagcttccagtggactac
gaagcgattgccgagaagatatggaatgaaaggaaaaggggaaagatcaactgtattata
gttgtcgctgaaggggctgcaagcgcatatacagttgcaagacatgttgaacacaggatt
ggatacgaaacaagaataaccattctcggccacattcaaaggggaggctctcccactgca
tttgatagagtacttgcttcaagaatgggatatgcgtcggttaaggcgcttgaagaaggt
aaagcgggaatgatgatgtcgttgaatggtgggaaaatcaaaggaatacctcttgaggaa
gtgctttcacacaaaaaagaactggatatggaactgatggaaatggcgaaaatactctct
taa

DBGET integrated database retrieval system