KEGG   Mesotoga prima: Theba_2293Help
Entry
Theba_2293        CDS       T02123                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mpg  Mesotoga prima
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Theba_2293
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Theba_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2465045..2467144)
Genome map
AA seq 699 aa AA seqDB search
MATVKIEDQKFKVDGKEISMYSGSVHYWRSKPEAWSGILDKVKDMGFNAITTYIPWEIHE
LQRGVFDFGEVEPSRDIDRFLTLCEEKGLYFAVRPGPQINSELTWFGFPERILEDPKLQA
RNAKGGKVVLTQVPRPIPALAYHSEEFLAEVDLWYDAIFSILEKHQPPKGNLVAVQVDNE
MGFFFNVNPYSTDYSDSSKALYRSFLKEKYNTVSELNKMYSSNYSGFDEIDPPGRFEGTR
KEELRYYLDWIEYREFYLITSMENLGNRMKSRGIHVPLFHNYPHPLGPGGAKGAPTTPFN
LPALEEKLGFVGFDIYSRKELYDHVKTIASYVSGCSRFPYIPEFIMGVWPWYIKPGDVTD
EVFVTKEALMHGIKEFNRYMLVDRNKWLGSPINRKGVVKEDSYAAHKKVGTNLMKIRWND
FAKCDDVLLVVNRDYDRLEAATTLLPVVGDFLEPVFGFSEYPSSVIVSDENLGFRRPIQQ
HKSTWFDAFYRALTEGGVVFSLGDTAQSVEALKKHKVLVISAFDYIGKKTADKLAEYIET
GGTVVLGPEVPKLDDTFSSESALSKLVSSTTGKPVLNSNGMEIGKKFACGKGSLIQIFEL
ESVSSGLIEILDSVKVFRIDKGKSVADLVLYKGKTSDEYILFVANPSDKKIEIDIPLPSV
SESITDIWEEKKEQISAGRLVTEVCAHDIRIFSWKAINA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagttaaaattgaagatcagaagttcaaggtcgacgggaaagagatttccatg
tacagcggatcggttcattactggcgtagcaaaccggaagcctggagcggaattcttgat
aaggtgaaggacatgggcttcaatgcaattaccacttacattccctgggaaatccacgaa
ttgcagagaggcgtttttgatttcggggaggtagaacccagcagagacatagacagattc
ttgacgctttgcgaagaaaagggtttatatttcgcagtcaggccgggcccacagataaat
tcggagcttacctggttcggtttcccggagagaatcctcgaagacccaaagctacaggca
agaaacgcaaagggtgggaaagttgtgttgacacaagtgccaagacccattccggcactc
gcttatcattcagaggaattcctcgccgaagttgatctatggtatgatgcgatcttcagc
atactcgagaagcatcaaccaccgaaagggaatctcgtcgctgtgcaagtagacaacgag
atgggattctttttcaatgtcaatccatattcaacagattacagcgactcttcaaaggct
ctttaccgaagttttttgaaggagaaatacaacacggtttccgagcttaacaaaatgtac
tcttcaaattacagtgggtttgacgagatagatcccccaggccgttttgaagggacaagg
aaggaagagcttcgttattacctcgattggatagaatacagagaattctacctgataacc
agcatggagaacttaggtaatcgaatgaagtcaagggggattcacgtgcctctattccac
aactatccacatcctctaggtcccggtggagcaaagggagctcctactactccgttcaat
ctccctgctctcgaagaaaagcttggctttgtcggcttcgatatctattcaagaaaggaa
ctctacgaccacgtcaagacgatcgcatcttatgtctctggatgcagcagatttccatat
attccagagttcattatgggtgtctggccgtggtatataaagcccggagacgtcactgac
gaggttttcgtaacgaaagaagcgcttatgcacgggataaaggaattcaacaggtacatg
ctagttgatagaaacaaatggctcgggtcccctatcaacagaaagggagtcgtaaaagaa
gactcttacgccgctcacaagaaagtcgggaccaatcttatgaagatacggtggaacgac
tttgccaagtgtgatgacgtactacttgtggtcaatagagattacgacagactagaagcc
gcaactactcttcttcctgtagtaggagattttctagaaccggtctttggattctccgaa
tatccaagttcagtaatagtctccgatgaaaatcttggattcagaagaccaatacagcag
cacaagagtacatggttcgatgctttctacagggcattgacagaaggtggagtagtgttc
agcttgggagataccgctcagtcagtcgaagcactcaagaagcacaaggttttggttatc
tctgctttcgactacataggaaagaaaacggccgacaagttggccgagtacatcgaaacc
ggcggtacggtagttctgggtccggaggttccaaagcttgacgatacgttcagctcagag
tctgccctaagcaagctggtgagttccacaacagggaagccagtgctcaatagcaacggc
atggaaatcggaaagaaattcgcatgtggtaaaggctccctaatacagattttcgagctg
gaaagtgtcagttccggtttgatcgagatcttggattccgttaaggtcttcagaatagac
aaaggtaaatccgttgcagacttggttttgtacaagggcaagacaagtgatgagtacatt
ctctttgtggcaaatccatcagacaagaaaattgaaattgacattccgttgcctagcgtt
tccgagagcattacagacatctgggaagaaaagaaggaacagatctcggctggaagatta
gtgacggaagtttgcgcgcacgacattaggatcttcagctggaaggcaatcaacgcttag

DBGET integrated database retrieval system