KEGG   Mesotoga prima: Theba_2402Help
Entry
Theba_2402        CDS       T02123                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mpg  Mesotoga prima
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Theba_2402
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Theba_2402
Enzymes [BR:mpg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Theba_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608407..2609675
Genome map
AA seq 422 aa AA seqDB search
MSQLVVMGNTSLKGEIKASGSKNSVLPILAATVMIEEPVVIKNVPELRDVQTMISILQQI
GKTVSFENETVTVMPGEILVGNVPYELVKKMRASFNIIGPLTMICGWAKVGKPGGCNIGQ
RPVDFHLKGLEAFGFRITEEHGDVMAVIPNSFEKEIVYALPFPSVGATEQLMTTAALMEG
STITIENAAREPEISDLQNFLNACGAQIAGASTPTIKITGVRNLHGSEYSVIPDRIETGT
YLLGTIATKGDVKIHGTRSDHLISLLSILEEMGAGIEKGQDYLHAFWKGPLKPVRISSEP
YPGFPTDLQPIITAVLATVEGTSVIEENVFENRFGYVDELNRMGARIKVSSSHANICGVD
KLSGAEVVAPDIRAGAALVIAGLAADGETIINNVTHLFRGYERFQEKLRTLGAKITFYPD
EE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctcgttgttatgggaaacacaagtctcaaaggcgagataaaggcaagcggc
tccaagaattcagttttgcctattctggcagcgactgtcatgatcgaagaaccggtagta
ataaaaaatgtccctgaactgcgcgatgttcaaacaatgatttccatacttcagcagatt
ggaaagacagtctcattcgaaaacgagacggtaacggtaatgccaggggaaatactagtg
ggaaacgttccgtatgagcttgtaaagaaaatgagggcctcattcaatataattggccct
cttaccatgatctgcgggtgggcaaaggtaggaaaacccggtggctgcaacatcggtcag
cgtcccgtcgactttcatctgaagggtctcgaggcctttggtttcagaataacggaggaa
catggagacgtcatggccgtcattcccaacagttttgaaaaagagattgtctatgcgctt
ccctttcccagtgttggcgcaaccgagcagctcatgactacggcagctctaatggaggga
agtacgataactattgagaatgctgcccgagagccggaaatatcggatctccagaacttc
cttaatgcgtgtggcgcacagattgccggtgcctcgacacctaccataaagattaccgga
gttagaaatctccatggatcggaatactcggttattcccgacagaattgaaacgggcact
tatctccttggaacaatagccaccaaaggcgacgtgaagattcacggaacaaggtcggac
cacctgatttctctcctgagtattcttgaggagatgggagcaggtatagagaaaggccaa
gactatttgcacgccttctggaagggaccgctgaagccggtaagaatatcgtcggaacca
taccctggatttcctactgacctccagccgataataactgccgtgctggcaacggtcgaa
ggcacatccgttatagaagagaacgtctttgaaaacagatttggatacgtagatgaacta
aatcgaatgggagcaagaatcaaagtatcgagtagccacgctaacatatgcggcgtcgat
aaactcagtggagcagaggtcgtagcccctgacataagagccggcgctgcacttgtgata
gcaggactggcggccgatggagaaacaataattaacaacgttacccatctcttcagaggg
tatgagaggtttcaggagaaattgagaacactgggagccaagataaccttctatcccgac
gaagaatga

DBGET integrated database retrieval system