KEGG   Mesotoga prima: Theba_2461Help
Entry
Theba_2461        CDS       T02123                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Organism
mpg  Mesotoga prima
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2667679..2668641)
Genome map
AA seq 320 aa AA seqDB search
MKLKFINGVTPVNRLEWIEEYLGLPFELFCKHDELTGFITSGNKIRKLEYLLKDALEKKA
DTVFTCGGIQSNHCRATAMAARSLGMQPVLFLRGRPMEIPQGNVLLDTMVGSDIHYVTKE
EYSRIDEIFAKKKEEYENKGRKVYLIPEGGSNALGARGYVDAVKELSGQINLDGVEAIFT
AVGSAGTYAGILAGLRILGYNTGVIGINVTKDPSSIFVEKTKRLIGEMREYEIDVSIDDG
EIEIVDDFSGPAYAVPSEEDIELIKSLARERAFFLDPVYTAKAFRGMLQISRERFAGKRV
VFIHTGGLFKLFDNPATYVK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgaagttcattaacggtgttacgcccgtgaacaggcttgaatggatcgaagag
taccttggccttccattcgaactcttctgcaagcacgacgagttgactggcttcatcacg
agcggcaacaaaatcagaaagctcgagtatcttctgaaagatgctctggaaaagaaggca
gacaccgtcttcacctgcgggggaattcagtcgaaccactgcagggcgacggcgatggcg
gcgagatcgctcggaatgcagccggtactcttcctcagggggaggccgatggagattcct
caagggaacgtccttttagataccatggtgggaagcgacattcattatgtgaccaaggag
gagtattcgagaatagacgagatcttcgccaagaagaaggaagagtacgagaataaggga
aggaaggtttacctgatcccggagggcggttcaaacgcgctgggagcgagaggttacgtg
gacgccgtgaaagaactctctggccagatcaatctcgacggagttgaagccatcttcact
gcagttggcagcgccggaacctatgcgggaattctggcagggctaagaatacttggctac
aacaccggagtcataggaataaacgttacgaaggacccttcttcaattttcgtggaaaag
acaaagagactaataggcgagatgagggagtacgaaatagacgtatcgatagatgacggc
gagatcgagatagtcgacgacttctcgggccctgcttatgccgtgccttcggaagaggat
atagagcttataaagagccttgccagggagagagccttcttccttgaccccgtctatacg
gcgaaagccttcaggggaatgcttcagatctcaagggaaaggtttgccgggaagagagtt
gttttcatccatactggtggattgttcaagctgttcgacaatccggccacttatgtaaag
taa

DBGET integrated database retrieval system