KEGG   Mesotoga prima: Theba_2576Help
Entry
Theba_2576        CDS       T02123                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mpg  Mesotoga prima
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2800452..2801081)
Genome map
AA seq 209 aa AA seqDB search
MDLRKELVLFARLAWDRRLTESTGGNMSVRNGDHFVITPTTMVKHFLTEEDLVEVDLNGR
KVSGRREPSSEYRMHLKIYRECEDVVSVFHAHPVYATTIAVQQKKFPVNILPETALMLAP
ITYLPYRMPGTDDFAEVFDEGLKLGSRTFVLRNHGVTVGGSSIEEAYAKLETLEFLAQIT
LLSGAKPGYLEIPSEDVEKFLKKIRGSKE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggatttgagaaaagagctggtccttttcgcgaggctggcatgggacagaagacttacc
gagagtaccggtggaaatatgagcgttagaaatggagatcattttgtgattacccccaca
acaatggtgaagcactttctcacggaagaggatcttgtcgaggtagatctgaatggaagg
aaagttagtgggaggcgcgaaccatcatcggaatacaggatgcatttgaagatttacaga
gagtgtgaagacgtggtttccgtcttccatgctcatcccgtttacgcgacaactatcgca
gttcagcagaagaagtttcctgtgaatattcttcctgaaactgcgctcatgctggctccg
ataacctatcttccctacagaatgcctggtacggatgattttgcggaggtattcgacgag
ggtttgaagcttggctcgcgaaccttcgttttgagaaaccacggtgttacagtcggcgga
agtagtattgaagaggcatatgcaaagctcgagacgctggagtttctggctcagatcacc
ctcctttccggtgccaaacccggttacctcgaaatcccttccgaagatgtggagaagttc
ttgaaaaaaataagaggatctaaggagtag

DBGET integrated database retrieval system