KEGG   Mesotoga prima: Theba_2587Help
Entry
Theba_2587        CDS       T02123                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpg  Mesotoga prima
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Theba_2587
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Theba_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2813839..2814771
Genome map
AA seq 310 aa AA seqDB search
MNKVTVFGSYVMDLTTLSPHIPVVGETVFSGPFKMGPGGKGFNQAVAARKAGSDVKFMTK
IGKDLFAPFVKDAFDKFGITKDYLLESDTAGTGVALIIVDENNGNNAIAVAPEACNELTV
EDVIRHRDIFTSSDVFLTQFEANLDATYEAIKLARDSGARVLLNPAPVKEFDHSILKYVD
IIMPNEIEASLMTGIPLDGMESIEAIASELKKSVDTVLITLGGKGVYCPSVNGGLVPACK
VKTIDTTGAGDAFAGVFAAYLSRGESLERAIDYARAGAAISTTRFGTSPSMPEREEIEAL
VNEITGGDEK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagtgacagtatttggtagctatgtaatggatctcactaccctttctccccat
atacccgttgtaggagagacggtcttttccggtcccttcaagatgggccccggaggcaag
ggattcaaccaggctgtggctgccagaaaggcaggatctgacgtcaagttcatgactaag
atcggcaaagacttgtttgctccatttgtgaaggatgcattcgataaatttggaatcaca
aaagattatcttctcgagtcggatactgccggaacaggagtcgctctgataatagtagat
gagaacaacggaaacaacgccattgcagttgcgccagaggcctgcaacgagttgactgtc
gaagatgttataagacacagagatatcttcacctcttccgatgtctttcttacccagttt
gaagcgaatctcgacgcaacttacgaggcgataaaactcgccagagactccggagcgaga
gttctgctaaaccccgcgcccgtgaaggaatttgatcattcgatcctaaaatatgtcgac
attattatgccgaacgagatagaggccagcctaatgacgggaattccgctggacggaatg
gagtcgatagaggccatagcttctgaattgaagaagtcggtggacacagtgctgataact
ctcggaggcaagggggtttactgtccatcggtcaatggagggctcgttcccgcctgcaag
gtaaagactatcgatacaaccggagctggagacgcatttgccggagtttttgctgcatat
ctctcgaggggagagagcttggaaagagccatcgactacgcccgtgccggagcggccatt
tctacgactagatttggcacttcgccttcaatgccggaaagggaagaaatagaagctctc
gttaatgagataactggaggcgatgagaaatga

DBGET integrated database retrieval system