KEGG   Mesotoga prima: Theba_2605Help
Entry
Theba_2605        CDS       T02123                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpg  Mesotoga prima
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Theba_2605
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Theba_2605
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Theba_2605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2831529..2833067
Genome map
AA seq 512 aa AA seqDB search
MNFDEAVGRLFLIGIPGPEIDSETERTLREVKPGAVILFSKNIVDAVQVRALVDDIQRVL
GYKPAIAIDQEGGIVSRLRDGFSVSPGAMAIAATGTTENSFVVGRILAREMNAIGVNWNL
APVVDINCNPKNPGIGVRSFGDSPDQVIAYARAFVEGMKSERVMSCLKHFPGKGRVDVDA
HLDLPILDIPQSLLYEYELRPFKEIQADSIMPSHIYMPQLQASRVPASMSREILTDLARN
VLNYRGVLVADDLGMGGVSNYFTPEEAAIQGLRNGMDYLTYCHDPVVQRRVKKILIREIE
KSPELEKRFQESLQRVEKFRVEATSADRFSIEEIASQESLNAMQEISDRSITAILEDSSL
LPLPIESVSGIFSVRLSRLVQVEDGPQKGVPTVAREIAQMSDCPIIDFSPNITVEEADRL
AANSPGKGVRLVFTENAHLHEGQRKLLLKLSQRTGRTLVIALRNPYDAFLEGVKNCIISY
GYEAVSQRSLKKILDGTIKAQGKLPIKIPQEV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgacgaagccgtaggacggttgtttttgattggaatacccggtccggaaatc
gatagcgagaccgaaaggacacttcgagaagtcaaacccggggcggttattctcttttcg
aagaatatcgtcgatgctgttcaggtaagggctctcgtagatgacattcaaagagtcctt
ggatacaagcccgcaattgccatcgatcaggaaggtgggatagtaagccgactgagggac
ggcttctctgtttcgcccggagctatggcaatagccgccactggaaccaccgaaaactcc
ttcgttgttggaagaatacttgccagagagatgaacgccataggtgtgaattggaatctc
gctcccgtcgtcgatattaactgcaatcccaaaaacccgggaatcggagtaaggagtttc
ggcgattctccggatcaggttatagcctacgcaagggcctttgtagagggtatgaagagt
gaaagagtgatgagctgtttgaagcattttcccggcaagggaagggtagatgttgacgct
catctggatttaccgattctggacatcccccaatctttactttatgaatacgaactgaga
ccattcaaggaaattcaagcagactcgataatgccttcgcatatatacatgcctcagctt
caggcctcccgggttccggcatcgatgtcgagagagatattgacggatcttgccaggaac
gtgctgaattatcggggggtccttgtcgcagatgatctgggaatggggggagtgagcaac
tacttcacgcccgaggaagccgctatacagggtctgagaaatggaatggattatctgact
tactgccacgatccggttgtccagagaagagtcaagaagattctgattagagagatagaa
aaatcgccggagctggaaaagcgtttccaggaatctctacaaagagttgagaagttccgg
gtagaggcgaccagtgccgacaggttctcgatcgaagagatcgcctcccaggagagtctg
aatgcgatgcaggagatttccgatagatctatcacggccattctggaagacagttctctt
cttccccttccaatcgagagtgtgagcggaatattctctgtaagactttcaagattggtt
caagttgaagacggtccccagaagggagttcccactgtggccagagagatcgcgcagatg
tcagactgtccgataattgacttctcgcctaacataaccgtcgaagaagcggacagactg
gctgccaattccccgggcaagggagtaagattggtctttacggagaacgctcaccttcac
gaaggtcagagaaagttactcttgaagctttcgcaaagaacgggaagaacgctggtaata
gcattgagaaacccatacgatgctttcctggaaggcgttaagaactgcataatcagctac
ggctacgaagcggtttcgcaaaggagccttaagaagattctagacggcacgatcaaagcg
caagggaaacttccgataaagataccgcaggaggtctag

DBGET integrated database retrieval system