KEGG   Microlunatus phosphovorus: MLP_01910Help
Entry
MLP_01910         CDS       T01535                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mph  Microlunatus phosphovorus
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mph00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196246..197757
Genome map
AA seq 503 aa AA seqDB search
MTEFEGTAVSNQMELIAYANRLGGSLPGLKAILDGPLAGLFSGVHLLPFFPPFDGADAGF
DPVDHSEVDPRLGTWHDIAAIADGHEVMVDLIVNHVSAASPPFLDWLAHGSSSDFARMFL
TYDGVFPNGATEETLMRLYRPRPGLPFSPYTLADGTKRLVWTTFTANQIDIDVREPITCD
YLQKVLDRLEGAGVRRVRLDAVGYALKTPGSTSFMTPETFEFIGEITQWCRERELEVLVE
VHSYYQQQVEIAKQVDRVYDFALPPLILHALTAADADPLLAWMAIRPLNAVTVLDTHDGI
GVIDVGADAADRSRLGLLTPAQIDQLVETMHDNSGGTSRQATGSAAANVDLYQVNCTFYD
ALGADDDRYLLARALQFWTPGVPQIYYVGLFAGRNDVALLERTGVGRDINRHYYASADIE
DELQRPVVQALVHLIRFRNTHPAFDGQFSVSGGGRLLLAAWRTSDAVAELRADLATGTGT
VRWTAGGVMCEAPLDRLGEGIGR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgagttcgaggggactgccgtgtcgaatcagatggagttgattgcctatgccaac
cggctcggtgggagtctcccagggctgaaggcgatactggacggaccgctggcaggtctg
tttagtggcgtgcacctgctgccgttcttcccgcccttcgacggggctgatgcaggattc
gatcctgtcgaccacagtgaggtcgatccccggctcggcacctggcacgacatcgccgcg
atcgcagacggacacgaggtcatggtcgacctgatcgtcaatcacgtgtcggctgcatcg
ccaccgttcctcgactggctggcgcacggcagttcgtcggacttcgcacgcatgttcttg
acctatgacggtgtgtttcccaacggtgcgacggaggagaccttgatgcgtctctaccgc
ccgcgacccggtctcccgttcagtccgtacaccctcgccgatggcaccaagcgcctcgtc
tggaccacgttcaccgccaatcagatcgatatcgatgttcgtgagccgatcacctgcgac
tacctgcagaaggtgcttgaccgactggaaggtgccggcgtacgtcgggtccgattggac
gctgtcggctatgcgctgaagacgccggggtcgacctcgttcatgacgcccgagaccttc
gagttcatcggcgagatcacgcagtggtgtcgcgaacgtgagttggaggtcctggtcgag
gttcactcctactatcagcagcaggtcgagatcgccaagcaggtcgaccgcgtctacgac
ttcgcgttgccgccactgatcctccacgccctcaccgctgccgatgccgaccctttgctt
gcgtggatggcgattcggccgctcaatgcggtgaccgtgctcgacactcatgacgggata
ggggtcattgatgtcggcgccgacgcagcggaccgatccaggctcgggcttctcactccc
gcgcagatcgaccaactggtcgagaccatgcacgacaactcaggtggtacgtcccggcag
gcgaccgggtccgccgccgccaacgtcgatctctatcaggtcaactgcaccttctacgac
gcgctcggagctgacgacgaccgctatctcctggcgcgggcgctccagttctggacgcca
ggcgttccgcagatctactacgtcggcctgttcgctggtcgcaacgatgttgcactgctc
gagcggaccggagtcggtcgggatatcaaccggcactactacgcctcggctgatatcgag
gatgaactgcagcggccagtggtccaggcgctggtgcacctgatccgcttccgcaacact
catcctgccttcgatggtcagttctcggtgtcgggaggcgggcgcctgcttttggccgcg
tggcggacgagcgacgcggtggccgaactgcgcgccgatctggccaccggcaccggcacc
gtgcggtggaccgctggtggtgtgatgtgcgaagcacccctggatcggcttggcgagggg
atcggccggtga

DBGET integrated database retrieval system