KEGG   Microlunatus phosphovorus: MLP_02790Help
Entry
MLP_02790         CDS       T01535                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00010  Glycolysis / Gluconeogenesis
mph00071  Fatty acid degradation
mph00350  Tyrosine metabolism
mph00625  Chloroalkane and chloroalkene degradation
mph00626  Naphthalene degradation
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_02790
  Lipid metabolism
   00071 Fatty acid degradation
    MLP_02790
  Amino acid metabolism
   00350 Tyrosine metabolism
    MLP_02790
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MLP_02790
   00626 Naphthalene degradation
    MLP_02790
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MLP_02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: BAK33293
UniProt: F5XIW7
Position
complement(301754..302791)
Genome map
AA seq 345 aa AA seqDB search
MLAVRYAGYGMAPELVEMPSPVCPDDGVLLDVLATGVCRSDWHAWRGHDPVSLPHVPGHE
IAGVVSQIGRDVTRFAVGDLVTTPFVNGCGSCEFCLGGDAQVCPQQTQPGFTHHGSFAEQ
VALYAADTNLVRLPEGMDPVVAASLGCRFATAYRAVTARGRVGTGDLVAVFGCGGVGLSA
IQIAIALGAQVFAVDVSDLARQRAADLGAVALAPDSVVERITDLTGGGVHVAIDALGSAS
TELAAVRSLRRRGRYVQVGLMLGPDARAPLPWDLVVAYELEVYGSHGMAACDYPAMLSMV
SSGILRPAELVGRVISLAEAPAALVAMDSPASSTAGMTVIDLTRH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcggtccgctacgccggctacgggatggcgcccgagctcgtcgagatgccgtcg
ccggtctgtccggacgacggcgtgctgctcgatgtgctggccaccggtgtctgccgctcg
gactggcatgcctggcgcggtcacgaccccgtgtcgctgccgcacgtgcccggccacgag
atcgcaggggttgtcagccagatcggccgggacgtgacccgattcgccgtcggcgacctg
gtcaccactccgttcgtcaacgggtgcggcagctgcgagttctgcctgggcggggacgcc
caggtgtgcccgcagcagacccagcctggcttcacccaccatggctccttcgccgaacag
gtcgcgctgtatgccgccgacaccaatctcgtccggcttcccgagggcatggacccggtc
gtggcggcatcgctcggttgccgattcgccaccgcctatcgcgcggtgactgcccggggc
cgggtcggcaccggcgacctggtcgccgtcttcggctgcggcggtgtcgggctctcggcc
atccagatcgccatcgcactgggcgcgcaggtcttcgccgtcgacgtctctgacctggcg
cgacaacgggccgccgacctcggagccgtcgcgctggctcccgatagcgtggtcgagcgg
atcaccgacctgaccggcggtggcgtacacgtcgctatcgacgccctcggctcggcctcg
accgagttggcggccgtacgcagcttgcgccgccgcggccgctacgtccaggtcggcctc
atgctcgggcccgacgcccgggccccgctgccctgggatctcgtggtggcgtacgagctg
gaggtctatggatcccacggcatggctgcctgcgactacccggcgatgctgtcgatggtc
tcctccggcatcctgcgacccgccgagttggtcggccgcgtgatctcactcgccgaggct
cccgccgccttggtggcgatggactcccccgcctcctcaacggccggcatgacagtcatc
gacctcacccggcactga

DBGET integrated database retrieval system