KEGG   Microlunatus phosphovorus: MLP_03200Help
Entry
MLP_03200         CDS       T01535                                 

Definition
magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MLP_03200
Enzymes [BR:mph01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MLP_03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343492..345516)
Genome map
AA seq 674 aa AA seqDB search
MRTYPFSAVVGSDDMALALVLTSISPEVGGVLVRGEKGTAKSTMVRALAAVQPDQLVVQG
CRFACDPADPDPACPDGPHTDIIAVRRPARLVELPVGATEDRVIGSLDLQQALGSGQVSY
EPGLLAAAHRGILYVDEVNLLHDHLVDLLLDAAAMGRSTVERDGVSVAHAARLVLVGTMN
PEEGELRPQLLDRFGLTVEVAAPREPALRSEVVRRRLAYDADPTSFVARFADQEAELRDR
LAAAQQRIGEVRLSDWALDKIAGVCAGFEVDGMRADIVTARAAVAHAAWHDRSEVTRADI
RAAARLALPHRRRRNPFDAPGLDEDLLDQLLGDDDIEPDPDPEPPNPDPEPQAPDDNDDP
PPNGPDTTPNDQTDRSDPADSPPEPPRQSEQDAPSERGQPVPVSVSEPGQPYRARLLTAR
GTGSGEAGRRSRALTSVGRTVGSAPTAGARLHFPATVRAAATEQQRRGRIVGGRLRFDRT
DLRTAVTEGRESNLVLFCVDASGSMAARKRMAEVKTAVLSLLLDAYQRRDKVGLVTFRGF
EATLALPPTSSVEVAARRLSELPSGGRTPLAEGLLCAAETLRWERVRDPRRRPLLVLITD
GRATAGVDALARSRQAAAYVRSLGVDAVVVDCESGRMSLGLALGLATELQAEYLKLADVS
AEALAVVASTRRAA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacctatccgttctctgccgtcgtcggctccgacgacatggccctcgccctggtg
ctgacctcgatctcgccggaggtcggcggagtgctggtgcgtggcgagaaaggtacggcg
aagtccacgatggtccgcgccctcgccgcggtgcaacccgaccaactggtcgtgcagggg
tgccggttcgcctgcgatccggccgatcccgatccggcctgcccagacggtccgcacacc
gacatcatcgcggtccgccggccggcgcggctggtggagctgccggtgggtgctaccgag
gaccgggtgatcggctcactggatctgcaacaggcactcggctccggacaggtgtcgtac
gagcccgggctgctggccgccgcccaccgcgggatcctctatgtcgacgaggtgaacctg
ctgcacgaccacctggtcgacctgctgttggatgcggcggcgatgggacgctcgacggtc
gagcgcgacggcgtctccgtcgcccacgctgcccgactcgtgctggtcgggaccatgaac
cccgaggagggtgagctccgcccgcagctgctggatcgcttcgggttgaccgtcgaggtg
gccgccccgcgcgagcccgcactccgttcggaggtggtgcgccgccgactcgcctatgac
gccgatccgacctccttcgtcgccaggttcgccgaccaggaggcggaactgcgggaccgt
ctggctgcggcccagcagcggatcggcgaggtgcggctgtccgactgggcgctggacaag
atcgccggtgtctgcgccgggttcgaggtggacggtatgcgggccgacatcgtcaccgcc
cgcgccgccgtggcgcatgccgcttggcatgaccggagcgaagtcacccgggccgacatc
cgggccgccgctcgacttgccctcccccaccgccgtcggcggaatccgttcgatgcgccg
ggactggatgaggacttgctggaccagctgttgggcgacgatgacatcgagccggatccc
gaccccgaaccaccgaatcctgacccggaacctcaggcgcccgatgacaatgacgatccg
ccgccgaacggccccgacaccacaccgaacgaccagacagaccgaagcgacccggcagac
tctccgcccgaaccgcctcggcaatcggagcaggatgccccgagcgagcggggacagccc
gtgccggtgagcgtgtccgagccaggccagccctatcgggctcggctgctgaccgctcgc
ggcaccggctcaggggaagccggccgccggagccgggcgttgaccagcgtcggccggacg
gtcggctcagctccgaccgctggggcgcgactgcactttccggcgacggtccgggctgcg
gcaaccgagcagcagcgccggggtcgcatcgtcgggggtcggctgcgcttcgaccgtact
gatctgcggaccgccgtcaccgaggggcgcgagtccaacctggtgttgttctgcgtcgac
gcctccggttcgatggccgcccggaagcggatggccgaggtcaagaccgcggtgctgtcg
ctgctgctggacgcctatcaacgccgcgacaaggtcggtctggtgactttccgcggcttc
gaagccacgctcgcgctgccgcccacgtcctcggtggaggtcgccgcacggcgactgagc
gagctgccgagcggtgggcgtaccccgttggccgaagggctgctgtgcgcggcggaaacc
ctgcgctgggagcgggttcgcgatccacggcgccgcccgctgttggtgctgatcactgat
ggtcgagccaccgctggggtggacgcactggcgaggtctcgacaggcggcggcgtacgtc
cgctcgctcggggtcgacgccgtcgtggtcgactgcgagtccggtcggatgagcctggga
ctcgcattgggtctggctaccgagcttcaagcggagtatctcaagctggccgacgtcagc
gccgaggcgctggccgtcgtggcgagcacccggagggcagcatga

DBGET integrated database retrieval system