KEGG   Microlunatus phosphovorus: MLP_03240Help
Entry
MLP_03240         CDS       T01535                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_03240
   01230 Biosynthesis of amino acids
    MLP_03240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_03240
   00051 Fructose and mannose metabolism
    MLP_03240
   00562 Inositol phosphate metabolism
    MLP_03240
Enzymes [BR:mph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MLP_03240
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MLP_03240
  Exosomal proteins of bladder cancer cells
   MLP_03240
  Exosomal proteins of melanoma cells
   MLP_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(349284..350117)
Genome map
AA seq 277 aa AA seqDB search
MAYREEGARRRYLIGMSTKMYFSHARTLEWCRQVAELSRMHPAVVEGRAELFVLPGFLSV
AEVASMLEPVRAAGSGGSEARFWSVGAQDACWADDGPYTGEVSAAQLAEVGARLVEVGHA
ERRRLFGEDDEVIAAKTAAILRHGLTPVLCIGETERVDPEAAVEVCQAQLESALAPARSA
GHQGPVVIAYEPVWAIGASEPAGVEHIVGVCGPLRAALAADLDYSGDVIYGGSAGPGLLR
EVGEHVDGLFLGRFAHNPQAIKGILDDVLTLGSATSA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcgggaggagggtgctcgacggcgctacctgatcgggatgagcacgaagatg
tacttcagccatgcccggaccctggaatggtgccgccaggtggccgagctgagccggatg
catccggcggtcgtcgaaggacgagctgaactgttcgtgttgccggggttcctgtcggtc
gccgaggtggcttcgatgctggagccggttcgggcggctggctcaggtggctcagaagcc
cgattctggtcggtcggagcgcaggatgcctgctgggccgacgacggtccgtacaccggt
gaggtcagtgccgcgcagttggcagaagtaggcgctcgattggtcgaggtcggccatgcc
gagcggcgccggctgttcggcgaggacgacgaggtgattgcagcgaagactgcagcgatc
ctgcgacacgggctgactccggtgctctgcatcggcgagaccgagcgggtggacccagag
gcggcagtcgaggtctgccaggctcagctcgaatctgccttggcgccggcccgttcggct
ggtcatcagggtccggtggtgatcgcgtacgagccggtctgggcgatcggagcctcggag
ccagccggggtggagcacatcgtcggagtctgcgggccgttgcgggcggccttggctgcc
gatctggactactccggggatgtgatctacggcggcagtgccggacctggtctgctgcgc
gaggtcggcgagcacgtggacggcctgttcctgggccgcttcgcccacaatccgcaagcg
atcaagggcatcctcgacgacgtactcaccctgggctcggcgacctcggcctga

DBGET integrated database retrieval system