KEGG   Microlunatus phosphovorus: MLP_03890Help
Entry
MLP_03890         CDS       T01535                                 

Gene name
purC
Definition
phosphoribosylaminoimidazole-succinocarboxamide synthase (EC:6.3.2.6)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
mph  Microlunatus phosphovorus
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mph00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434892..435785
Genome map
AA seq 297 aa AA seqDB search
MAREQGRSWTEIGRALGVTKQTAWARLARVVAEGKTKIVEEVGNGEVLVRSKDDITAGDG
AKHDVIDGKAAASTRTTGNIFRLLERHGIPTHFVNGVDDVTFRAREVEMIPLELVARRYA
TASFKDRFPDLVDGALLDEVVFEVFEKDDANHDPLLEFDFDASVLRRYVPNDKAAEAIGP
VARAGDFISEEPLGESRYADVSPELIARLRSRTVSTFEVIENAWKQQGGVYIDVKIECGF
DRESGELLVADVIDSDSGRLRFGEIDMSKQSYRDGTATLPEIKRKFDEVAALTDRFV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgagcaagggcgctcgtggaccgagatcggtcgggctctgggtgtcaccaag
cagaccgcatgggcgcggttggcgcgtgtggtggcagaaggcaagaccaagatcgtcgag
gaagttggcaacggtgaggtgctggtccgcagcaaggacgacatcaccgccggcgacgga
gccaagcacgatgtgatcgatggcaaggctgccgcgtccacgcgtacgacaggcaacatc
ttccgactcctcgagcgccacggcatcccaacgcacttcgtgaacggtgtcgacgacgtc
accttccgggcgcgcgaagtggagatgattccgctggagttggtggcgcgtcggtacgcc
accgccagcttcaaagatcgctttcctgacctggttgatggcgcactcctcgacgaggtg
gtctttgaggtcttcgagaaggacgatgccaaccacgacccgctgctggagttcgatttc
gacgccagcgtcctacgacggtacgtgcccaacgacaaggcggccgaggcgattggccca
gttgccagagctggtgacttcatcagcgaagagccgctgggtgagagccgctacgccgat
gtttcgccggaactcatcgccagacttcggagccgtaccgtttcgactttcgaggtcatc
gagaacgcttggaagcaacaaggtggggtctacatcgacgtcaagatcgaatgcggcttc
gatcgtgagagtggtgaactcctggtagccgacgtcatcgacagcgactccggcagattg
cgcttcggcgagattgacatgtccaagcagtcgtatcgagacggcacggccaccttgccg
gagatcaagaggaagttcgacgaggtggctgctctcacagatcgtttcgtgtga

DBGET integrated database retrieval system