KEGG   Microlunatus phosphovorus: MLP_04360Help
Entry
MLP_04360         CDS       T01535                                 

Gene name
bkdC
Definition
dihydrolipoamide acyltransferase E2 component (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_04360 (bkdC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_04360 (bkdC)
   00020 Citrate cycle (TCA cycle)
    MLP_04360 (bkdC)
   00620 Pyruvate metabolism
    MLP_04360 (bkdC)
Enzymes [BR:mph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MLP_04360 (bkdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486854..488290
Genome map
AA seq 478 aa AA seqDB search
MAIKEFRLPDPGEGLVEADIVTWRVAVGDQVKINDILVEIETSKSLVELPSPYEGTVTGL
LVSEGDTVDVGVPIIAIDDGVAAPSAPAAPAEAADGDRVANLVGYGPKQTDSRRRPRKGA
AGGPEAETHEQVNSTFAVSAPVSRRADEREPLQSTAAQSHGGPLPQPGPAAAETSPPSTG
PVLAKPPVRKLARDLGIDLAAVAGTGSGGVITRADVEAAAAAPAAEVVAGPSFAAPPVSA
AAEDQRIPIKGVRKAMAAAMVQSAFTAPHVTVWVETDVTATMDLVQAIRARRDFAEVKVS
PLLIVAKAVLIALKRNPALNSSWDEVAQEIVLKAGVNLGIAAATPRGLIVPNIKNADRLS
LLELAQAFAALISSARSGKTTPEEMARGSFTITNIGVFGVDGGLPILNPGEAGILAVGQI
VRKPWVVGSGDDERIEPRWVTTIGLSFDHRLADGQQGSTFLADVAAILADPGMALVLS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaggagttccggctgcccgatccgggcgaagggctggtcgaggccgacatc
gtcacctggcgggtcgccgtcggtgaccaggtcaagatcaacgacatcctggtggagatc
gagaccagcaagtcgctggtcgagctgccgagtccgtacgagggcacagtcaccggtctg
ctggtgagcgaaggcgacacggtcgacgtcggcgtaccgatcatcgccatcgacgacggc
gtggcggcgcccagcgctccggctgctccggcggaggcagcggatggtgaccgggtcgcg
aacctggtcggctacgggccgaagcagaccgacagcaggcgccgaccgcgcaagggtgct
gccggtggcccggaagccgagacacacgagcaggtcaacagcacgttcgcagtcagcgcg
ccggtctccaggcgtgcggatgagcgggagccgctgcagtcgacggccgcgcagtcgcac
ggtggtccgctgccgcagccaggtccggctgccgccgagacgtctccgccgtcgaccggt
ccggtgctcgccaaaccgccggtacgcaagctggcccgcgacctgggcatcgatctggcc
gccgtcgccggaaccggttcgggcggcgtgatcactcgcgccgacgtcgaggcggcggct
gctgctccggccgccgaggtcgttgctgggccatcgttcgcggcaccgccggtctccgcg
gccgccgaggaccagcggattccgatcaagggtgtccgcaaggcgatggcggccgcgatg
gtgcagtcggcgttcaccgcaccgcatgtcacggtctgggtggagaccgatgtcaccgcc
accatggacctggtgcaggccatccgggcccgtcgtgacttcgccgaggtcaaggtctcg
ccgctgctgatcgtcgccaaggcggtgctgatcgcgctgaagcgcaatcccgcgctcaac
tcatcgtgggacgaggttgcccaggagattgtcctcaaggccggggtgaacctggggatc
gccgccgccacgccgcgcgggctgatcgtgcccaacatcaagaacgccgatcggctgagc
ttgctggagttggcgcaggcgttcgcggccttgatcagttcggctcgatctggcaagacc
acgcccgaggagatggcccgcggcagcttcacgatcaccaacatcggcgtgttcggggtc
gatggtggcctgccgatcctcaacccgggcgaggccgggatcctggccgtcggtcagatc
gtccgcaagccgtgggtggtcggttccggcgacgacgagcggatcgaaccgcgttgggtg
accacgatcggactgtccttcgaccaccgcctcgccgatggccagcagggctcgaccttc
ctggccgacgttgcggcgatcctggccgacccaggcatggcactggtcttgtcctga

DBGET integrated database retrieval system