KEGG   Microlunatus phosphovorus: MLP_07840Help
Entry
MLP_07840         CDS       T01535                                 

Definition
(GenBank) putative hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00220  Arginine biosynthesis
mph00330  Arginine and proline metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01130  Biosynthesis of antibiotics
mph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MLP_07840
   00330 Arginine and proline metabolism
    MLP_07840
Enzymes [BR:mph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MLP_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAK33798
UniProt: F5XLR9
Position
complement(863201..864100)
Genome map
AA seq 299 aa AA seqDB search
MSATAVPQPADTHLRLIWPQWQGAGSSSVRQFTTEFPFDVGRRGYAVGAKVLEAVLPEHD
GPTAVVPVEMGDRGLEERDGIEAKTIVLEQLRAALEIIGEHDPARITTLGGECSVSMAPF
SYLIDKYGDDIAVMWIDSHPDMGTGEGEYPGYHAMVVSALTGHGDPELLDLLPATTTSDR
VALVGMHDWTDPTLPAIADEWGLTVFGPDALRTSSAALLDWIRATGASKVAIHFDVDTID
ADEVRFGLGYDKGGLTRAEARRVVADIDAVTDVVAFTIAEYTPRQVMQLQQLLADFPLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcaacagcagtaccgcagcccgccgatacccatctccggctgatctggccgcag
tggcagggcgcgggcagcagcagcgtccgtcagttcaccaccgagttcccattcgacgtc
ggacgacgcgggtacgcggtcggcgcgaaggtcctcgaagccgtgctgcccgagcacgac
ggcccgaccgccgtagtgccggtcgagatgggcgaccgcggtctggaggagcgcgacggc
atcgaggcgaagacgatcgtgctcgagcagcttcgggctgcgctggagatcatcggcgag
catgatccggcccgcatcaccacgctcggcggtgagtgctcggtcagcatggcgccgttc
tcctacctgatcgacaagtacggcgacgacatcgcggtcatgtggatcgactcccacccc
gacatgggcaccggcgaaggcgaataccccggctaccacgccatggtcgtctcggccctc
accggccacggcgatcccgagctgctcgacctgttgccggccaccaccacctccgaccgg
gtcgccctggtcggcatgcatgactggaccgacccgacgctgccggcgattgccgacgaa
tggggcctgaccgtcttcgggcccgatgcgctgcgcaccagcagcgctgcgctgctcgat
tggatacgcgccaccggcgccagcaaggtcgccatccacttcgacgtcgacacgatcgac
gccgacgaggtcaggttcggccttggctacgacaaaggcggcctgaccagggcagaagct
cgccgcgtggtagccgatatcgacgcagtcactgacgtcgtcgccttcaccatcgccgag
tacaccccgcgtcaggtcatgcagctccaacagctgcttgccgacttcccccttctgtga

DBGET integrated database retrieval system