KEGG   Microlunatus phosphovorus: MLP_08270Help
Entry
MLP_08270         CDS       T01535                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00511  Other glycan degradation
mph00520  Amino sugar and nucleotide sugar metabolism
mph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MLP_08270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MLP_08270
Enzymes [BR:mph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MLP_08270
Chaperones and folding catalysts [BR:mph03110]
 Intramolecular chaperones
  Others
   MLP_08270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: BAK33841
UniProt: F5XLW2
Position
complement(914478..916124)
Genome map
AA seq 548 aa AA seqDB search
MTTPTMPSARSATPRSVVPGSVVPRSVVPRPVSTEPRSGTFVLPAGLAIATDQPGWAAVV
RRLLSPGTGLELPESADGALRLTKDDSLAEEAYIVEVTEDGIELTAATPQGLNWATQTLR
QLLPPSVLRPAPSGDPLTLACVRIIDEPRFGWRGVHLDVCRHFMPLADLFRYVDLAALHK
YNVFHLHLTDDQGWRFASNRYPRLQERASWRSETQRHLQDFADGTPHGGFYTLDQLRALV
RYAKDRGVTVMPELEFPGHVLALLAAYPELGNHPETGYQPATTFGVFPEVLNLSDEAMRV
IFDLYEELLDIFDSPYIHVGGDECPRDEWVVSPAADELAAQRGLAGPEYLQRWLTEQLRD
WLADRGRRLVGWDEINDEGPLPGAVAMAWRDAAYGVKAAEAGMDVVMAPLSHTYFDFYAS
DDPNEAYAIGGLTTLEKAYAFEPLAGVPDEFQPRVLGTQCQLWREYIADTRRTDYMLYPR
ACAHAEVAWSAPDGRSYEEFLTRLGPHLDRLTALGVEYRPLAGPLPWQQGGTGALRRPIE
HGGPATES
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccgacgatgccgtccgcacgctccgccaccccgcgctccgtggttccgggc
tcggtggtgccgcgctccgtggtcccgcgcccggtcagcaccgagccgcgctcaggaacg
ttcgtgctgcccgcggggttggcgatcgccaccgaccagccgggttgggctgcagtggta
cgacggctcctctcccccggcaccgggctggagttgcccgagtccgccgacggcgcactc
cggttgaccaaggacgactcgctggccgaggaggcatacatcgtcgaggtcactgaggat
ggcatcgagctgaccgcggcaacgccccagggactgaactgggccacccagaccttgcgt
cagttgctgcccccgtcagtgctgcgaccggccccgtccggcgacccgttgactctcgca
tgcgtgcggatcatcgacgaaccacggttcggttggcggggcgtgcacctggatgtctgc
cggcacttcatgccgctggccgacctgttccgctatgtcgatctcgcggcgctgcacaaa
tacaacgtgttccacctgcatctgaccgacgaccagggctggcggttcgcctcgaaccgc
tacccgcggttgcaggagcgagccagctggcggagcgagactcagcggcatctgcaggac
ttcgccgatggcaccccgcacggcggcttctataccctcgaccagctccgcgccctggtg
cgctacgccaaggatcgcggcgtcaccgtgatgccggagctcgagttcccgggccatgtg
ctggccctgctggccgcctatcccgagctgggcaaccatcccgagaccggctatcagccg
gccaccaccttcggcgtgtttcccgaggtgctcaatctgtccgatgaggcgatgcgggtc
atcttcgacctgtacgaggaactgctggacatcttcgacagcccctacatccacgtcggc
ggcgacgagtgtccgcgtgacgaatgggtcgtctccccagccgcggatgagctggcggcg
cagcgagggctggccggccccgaatacctgcagcgctggctcaccgagcagctgcgcgac
tggctcgccgaccgcggccggcggctggtcggctgggacgagatcaacgacgagggccca
ctgccgggcgcggtggcgatggcctggcgcgacgctgcatacggggtgaaggccgccgaa
gcggggatggatgtcgtgatggctccgctcagccacacctacttcgacttctacgccagc
gacgacccgaacgaggcgtacgcgatcggcgggctgaccacgctggagaaggcgtacgcg
ttcgagccgctggccggtgtgccggatgagttccaaccccgcgtgctgggcacccagtgc
cagctatggcgggaatacatcgccgacacccggcggaccgactacatgctctacccgcgg
gcctgcgcgcacgcagaggtggcctggtcggcaccggacgggcgatcgtacgaggagttc
ctgacccgattgggtcctcatctggaccggctgaccgccctcggcgtcgaataccgaccc
ttggcgggcccgctcccctggcagcaagggggcaccggcgcgctgcggcgcccgatcgag
cacggtggacccgctaccgagagctga

DBGET integrated database retrieval system