KEGG   Microlunatus phosphovorus: MLP_08270Help
Entry
MLP_08270         CDS       T01535                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mph  Microlunatus phosphovorus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MLP_08270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MLP_08270
Enzymes [BR:mph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MLP_08270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(914478..916124)
Genome map
AA seq 548 aa AA seqDB search
MTTPTMPSARSATPRSVVPGSVVPRSVVPRPVSTEPRSGTFVLPAGLAIATDQPGWAAVV
RRLLSPGTGLELPESADGALRLTKDDSLAEEAYIVEVTEDGIELTAATPQGLNWATQTLR
QLLPPSVLRPAPSGDPLTLACVRIIDEPRFGWRGVHLDVCRHFMPLADLFRYVDLAALHK
YNVFHLHLTDDQGWRFASNRYPRLQERASWRSETQRHLQDFADGTPHGGFYTLDQLRALV
RYAKDRGVTVMPELEFPGHVLALLAAYPELGNHPETGYQPATTFGVFPEVLNLSDEAMRV
IFDLYEELLDIFDSPYIHVGGDECPRDEWVVSPAADELAAQRGLAGPEYLQRWLTEQLRD
WLADRGRRLVGWDEINDEGPLPGAVAMAWRDAAYGVKAAEAGMDVVMAPLSHTYFDFYAS
DDPNEAYAIGGLTTLEKAYAFEPLAGVPDEFQPRVLGTQCQLWREYIADTRRTDYMLYPR
ACAHAEVAWSAPDGRSYEEFLTRLGPHLDRLTALGVEYRPLAGPLPWQQGGTGALRRPIE
HGGPATES
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccgacgatgccgtccgcacgctccgccaccccgcgctccgtggttccgggc
tcggtggtgccgcgctccgtggtcccgcgcccggtcagcaccgagccgcgctcaggaacg
ttcgtgctgcccgcggggttggcgatcgccaccgaccagccgggttgggctgcagtggta
cgacggctcctctcccccggcaccgggctggagttgcccgagtccgccgacggcgcactc
cggttgaccaaggacgactcgctggccgaggaggcatacatcgtcgaggtcactgaggat
ggcatcgagctgaccgcggcaacgccccagggactgaactgggccacccagaccttgcgt
cagttgctgcccccgtcagtgctgcgaccggccccgtccggcgacccgttgactctcgca
tgcgtgcggatcatcgacgaaccacggttcggttggcggggcgtgcacctggatgtctgc
cggcacttcatgccgctggccgacctgttccgctatgtcgatctcgcggcgctgcacaaa
tacaacgtgttccacctgcatctgaccgacgaccagggctggcggttcgcctcgaaccgc
tacccgcggttgcaggagcgagccagctggcggagcgagactcagcggcatctgcaggac
ttcgccgatggcaccccgcacggcggcttctataccctcgaccagctccgcgccctggtg
cgctacgccaaggatcgcggcgtcaccgtgatgccggagctcgagttcccgggccatgtg
ctggccctgctggccgcctatcccgagctgggcaaccatcccgagaccggctatcagccg
gccaccaccttcggcgtgtttcccgaggtgctcaatctgtccgatgaggcgatgcgggtc
atcttcgacctgtacgaggaactgctggacatcttcgacagcccctacatccacgtcggc
ggcgacgagtgtccgcgtgacgaatgggtcgtctccccagccgcggatgagctggcggcg
cagcgagggctggccggccccgaatacctgcagcgctggctcaccgagcagctgcgcgac
tggctcgccgaccgcggccggcggctggtcggctgggacgagatcaacgacgagggccca
ctgccgggcgcggtggcgatggcctggcgcgacgctgcatacggggtgaaggccgccgaa
gcggggatggatgtcgtgatggctccgctcagccacacctacttcgacttctacgccagc
gacgacccgaacgaggcgtacgcgatcggcgggctgaccacgctggagaaggcgtacgcg
ttcgagccgctggccggtgtgccggatgagttccaaccccgcgtgctgggcacccagtgc
cagctatggcgggaatacatcgccgacacccggcggaccgactacatgctctacccgcgg
gcctgcgcgcacgcagaggtggcctggtcggcaccggacgggcgatcgtacgaggagttc
ctgacccgattgggtcctcatctggaccggctgaccgccctcggcgtcgaataccgaccc
ttggcgggcccgctcccctggcagcaagggggcaccggcgcgctgcggcgcccgatcgag
cacggtggacccgctaccgagagctga

DBGET integrated database retrieval system