KEGG   Microlunatus phosphovorus: MLP_09920Help
Entry
MLP_09920         CDS       T01535                                 

Definition
oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mph  Microlunatus phosphovorus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MLP_09920
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MLP_09920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1088246..1089640)
Genome map
AA seq 464 aa AA seqDB search
MLMRDVVIVGGGIAGLAAAWRLRHWDSVLLEADHRVGGRIRSERRGAYWLNWGAHVLAGP
GSSTDDLLHEVGVTAVDVPGSLKALSMNGAFVPSGRIETYPLRVPMSMANRAAVFTSGAK
IAAAVLRYSRVVRQRPGESGAQRQQRIYDFENERTFADFVGDIPSDAAELFKVTVTRSAG
DMDQISAGSGIGYFSLVLSGGQGLGRGIVGGPSTLTEAVAVALGNRVQLGAQVQEIVHRR
DSVVVRYRQGDADHEVEARTVVLATPATVSHRVAVDLPEEVRGALGQIVYGPHVSAAFLT
NETSARPWDDVYAIACPKRSFAIALNQASIVRGSESVRQPGGSIMTFSPASLGRALLDKS
DEEIVNTHLADLEEVLGHGFADSVVEANASRWQDGSPYCAPGRAKLQPILTRPSSRVFLA
GDYLGTLYTESAITSGFAAAQEAASLLATDRQRHVPAITQHAAD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgagagacgtcgtcatcgtcggcggcggtattgccgggctggcagccgcttgg
cgattgcgccactgggactcggttctgctggaggccgatcatcgcgtcggcggtcgcatc
cgatcggagcgacggggagcctattggctcaactggggcgcccatgtgctcgccggcccg
ggcagctcgaccgacgacctgctgcacgaggtcggcgtcaccgccgtcgatgttcctggc
tcgttgaaggcgctgtcgatgaacggcgccttcgtcccgagtgggcggatcgagacctat
cccctccgggtgccgatgtcgatggccaaccgagcggccgtgttcacctccggcgcgaag
atcgccgccgcggtgctccggtattcccgcgtggtccgccagcggcccggcgagtccggc
gcccagcgacagcagcggatctacgacttcgagaacgagcggaccttcgccgacttcgtc
ggcgatatcccctccgatgccgcggagctgttcaaggtcacggtgacccgctcggccggc
gacatggaccagatctccgccgggtcgggcatcggctatttcagcctggtgctgagcggc
ggacaaggactcggccgcggcatcgtcggcggaccgtcgaccctgaccgaggccgtcgcc
gtggctctcggcaatcgcgtacaactcggcgctcaggtgcaggagatcgtgcaccgacgc
gactccgtcgtggtgcggtatcgccaaggcgatgccgatcacgaggtggaggcgcgtacg
gtcgtgctggcaaccccagccacggtctcccatcgggtggccgtcgacctgccggaagag
gtacgcggcgcgctcggccagatcgtctacggcccgcacgtgtcggcagcgttcctgacc
aacgagacctcggctcgtccttgggacgacgtgtacgccatcgcctgccccaagcggtcg
ttcgccatcgccctcaaccaggccagcatcgtgcgcggcagcgagtcggtccgccagccc
ggcggcagcatcatgaccttctctcccgccagcctcggccgagctctgctcgacaagtcc
gacgaggagatcgtcaacacccacctcgccgacctggaagaggtgctcggccatggattc
gccgacagcgtggtcgaggccaacgcctcccgttggcaggacggctcgccctactgcgcg
ccgggccgggccaagctacagccgatcctgacccgtccctcgagccgggtgttcctggcc
ggcgactacctcggcaccttgtataccgagtctgcgatcacctcgggcttcgccgccgcg
caggaggcggccagcctgctggcgaccgatcgccagcgccacgtccccgccatcacccag
cacgcagcggattaa

DBGET integrated database retrieval system