KEGG   Microlunatus phosphovorus: MLP_10000Help
Entry
MLP_10000         CDS       T01535                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mph  Microlunatus phosphovorus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_10000 (fdhA)
  Energy metabolism
   00680 Methane metabolism
    MLP_10000 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MLP_10000 (fdhA)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MLP_10000 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097375..1098589
Genome map
AA seq 404 aa AA seqDB search
MAGNRVVVYKGPGEVAVESIDYPKLELPDDVVNGLGIKKAAPHAVVLKLVTTNICGSDQH
MVRGRTTAPIGQTLGHEITGEVVEVGDDVLFVKEGDICSVPFNIACGRCRMCNEGKTGIC
LNVNPARAGAAYGYVDMGGWLGGQAEYVMVPFADFNLLKFPDRDAALEKILDLTMLSDIF
PTGYHGAYTAGVTTGSTVYVAGAGPVGLAAAYSAQLLGASVVIVGDMNADRLAQARSFGC
ETVDLSTGAGLADMIAELVGEPEVDAAVDAVGFEARGHGAGAAEAPATVLNDAMTVARAG
AGIGIPGLYVTGDPGAVDDNAKVGQIGVRLGLGWAKSHVLATGQCPVKQYNRQLMNMILA
DRAHIAKAVNAVTIGLDDAPQGYREFDAGAAKKYVIDPHGMVKS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacagagtcgtcgtctacaagggtcccggcgaggtcgcggtcgagagcatc
gactacccgaagctcgagctacccgatgacgtggtcaacggtctcggcatcaagaaggcg
gcgccgcatgcggtggtgctgaagctggtgacgaccaacatctgcggcagcgatcagcac
atggtccgcggccgtacgacggcgccgatcggccagaccctgggccacgagatcaccggc
gaggtggtcgaggtcggcgacgacgtgctgttcgtcaaagagggcgacatctgctcggtg
ccgttcaacatcgcctgtggccgttgtcggatgtgcaatgagggcaagaccggcatctgc
ctcaacgtcaacccggcccgcgccggtgcggcgtacggctacgtcgacatgggcggctgg
ctgggcggtcaggcggagtacgtgatggtgcccttcgccgacttcaacctgctgaagttc
cccgatcgggatgcggcactggagaagatcctcgatctgaccatgctgtcggacatcttc
ccgaccggctaccacggtgcctacaccgccggcgtgaccaccggctccacggtgtatgtc
gccggtgccgggccggtcggcctcgcggctgcgtactccgcgcagctgttgggtgcttcg
gtagtgatcgtcggtgacatgaatgccgaccgactggcccaggcgcgcagcttcggttgc
gagaccgtcgacctgtccaccggtgccgggttggccgacatgatcgccgagctggtgggc
gagcccgaggtcgatgccgcggtggacgcggtcggcttcgaggcccgtggtcacggggcc
ggcgctgctgaggcgccggcgaccgtgctgaacgacgcgatgaccgtcgcgcgggcgggg
gcggggatcggcatcccaggcctgtacgtgaccggtgatccgggtgcggtcgacgacaac
gccaaggtaggccagatcggggtccgtctcggcctgggttgggcgaagtcgcacgtgctg
gccaccggtcagtgtccggtcaagcaatacaaccggcagctgatgaacatgatcctggct
gatcgggcgcacatcgccaaggctgtgaacgcggtcaccatcggcctcgatgatgcccca
cagggctaccgggagttcgatgccggcgctgccaagaagtatgtgatcgaccctcatgga
atggtaaagagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system