KEGG   Microlunatus phosphovorus: MLP_10000Help
Entry
MLP_10000         CDS       T01535                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00625  Chloroalkane and chloroalkene degradation
mph00680  Methane metabolism
mph01100  Metabolic pathways
mph01120  Microbial metabolism in diverse environments
mph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MLP_10000 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MLP_10000 (fdhA)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MLP_10000 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C FAD_binding_3 PALP 2-Hacid_dh_C FAD_oxidored ADH_N_assoc Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-ProteinID: BAK34014
UniProt: F5XMU1
Position
1097375..1098589
Genome map
AA seq 404 aa AA seqDB search
MAGNRVVVYKGPGEVAVESIDYPKLELPDDVVNGLGIKKAAPHAVVLKLVTTNICGSDQH
MVRGRTTAPIGQTLGHEITGEVVEVGDDVLFVKEGDICSVPFNIACGRCRMCNEGKTGIC
LNVNPARAGAAYGYVDMGGWLGGQAEYVMVPFADFNLLKFPDRDAALEKILDLTMLSDIF
PTGYHGAYTAGVTTGSTVYVAGAGPVGLAAAYSAQLLGASVVIVGDMNADRLAQARSFGC
ETVDLSTGAGLADMIAELVGEPEVDAAVDAVGFEARGHGAGAAEAPATVLNDAMTVARAG
AGIGIPGLYVTGDPGAVDDNAKVGQIGVRLGLGWAKSHVLATGQCPVKQYNRQLMNMILA
DRAHIAKAVNAVTIGLDDAPQGYREFDAGAAKKYVIDPHGMVKS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacagagtcgtcgtctacaagggtcccggcgaggtcgcggtcgagagcatc
gactacccgaagctcgagctacccgatgacgtggtcaacggtctcggcatcaagaaggcg
gcgccgcatgcggtggtgctgaagctggtgacgaccaacatctgcggcagcgatcagcac
atggtccgcggccgtacgacggcgccgatcggccagaccctgggccacgagatcaccggc
gaggtggtcgaggtcggcgacgacgtgctgttcgtcaaagagggcgacatctgctcggtg
ccgttcaacatcgcctgtggccgttgtcggatgtgcaatgagggcaagaccggcatctgc
ctcaacgtcaacccggcccgcgccggtgcggcgtacggctacgtcgacatgggcggctgg
ctgggcggtcaggcggagtacgtgatggtgcccttcgccgacttcaacctgctgaagttc
cccgatcgggatgcggcactggagaagatcctcgatctgaccatgctgtcggacatcttc
ccgaccggctaccacggtgcctacaccgccggcgtgaccaccggctccacggtgtatgtc
gccggtgccgggccggtcggcctcgcggctgcgtactccgcgcagctgttgggtgcttcg
gtagtgatcgtcggtgacatgaatgccgaccgactggcccaggcgcgcagcttcggttgc
gagaccgtcgacctgtccaccggtgccgggttggccgacatgatcgccgagctggtgggc
gagcccgaggtcgatgccgcggtggacgcggtcggcttcgaggcccgtggtcacggggcc
ggcgctgctgaggcgccggcgaccgtgctgaacgacgcgatgaccgtcgcgcgggcgggg
gcggggatcggcatcccaggcctgtacgtgaccggtgatccgggtgcggtcgacgacaac
gccaaggtaggccagatcggggtccgtctcggcctgggttgggcgaagtcgcacgtgctg
gccaccggtcagtgtccggtcaagcaatacaaccggcagctgatgaacatgatcctggct
gatcgggcgcacatcgccaaggctgtgaacgcggtcaccatcggcctcgatgatgcccca
cagggctaccgggagttcgatgccggcgctgccaagaagtatgtgatcgaccctcatgga
atggtaaagagctga

DBGET integrated database retrieval system