KEGG   Microlunatus phosphovorus: MLP_14190Help
Entry
MLP_14190         CDS       T01535                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_14190 (tpiA)
   01230 Biosynthesis of amino acids
    MLP_14190 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_14190 (tpiA)
   00051 Fructose and mannose metabolism
    MLP_14190 (tpiA)
   00562 Inositol phosphate metabolism
    MLP_14190 (tpiA)
Enzymes [BR:mph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MLP_14190 (tpiA)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MLP_14190 (tpiA)
  Exosomal proteins of bladder cancer cells
   MLP_14190 (tpiA)
  Exosomal proteins of melanoma cells
   MLP_14190 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547351..1548145
Genome map
AA seq 264 aa AA seqDB search
MTLARKPLMAGNWKMNLNHVDAVGLVQKLVWTLEDKRHDPKKSEVVVLPPFTDLRTVQTL
VDGDRLELGYGAQDLSPFDGGAYTGDISADMLVKLGCSYVVVGHSERRQYHGEDDNTVNA
KTIQAIKKGLTPIVCVGEGLEVRRADQHVDFTISHVEGALARLTPEQISSLVIAYEPVWA
IGTGEVATPQDAQEVCGAIRRWLAERYGDATADQVRILYGGSVKASNVASIMAQPDVDGA
LVGGASLNPEEFAAIARFYDLPSL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactttggcccgcaagcccttgatggctggcaactggaagatgaatctgaatcatgtc
gacgccgtcggcctggttcagaagctggtctggactttggaggacaagcgccacgacccc
aagaagagtgaggtcgtggtcctcccgccgttcaccgatctgcgcaccgtgcagaccctg
gtcgacggcgatcggctggagttgggctacggtgcgcaggacctgtcaccgttcgacggt
ggcgcctacaccggtgacatctcggcggacatgctggtgaagctcggctgcagctatgtc
gtggtgggtcactcggagcggcgccagtatcacggtgaggatgacaacaccgtcaacgcc
aagacgatccaggcgatcaagaaggggctgaccccgatcgtctgtgtcggggagggcctg
gaggttcgtcgggccgatcagcatgtcgatttcaccatcagccatgtcgagggtgcgctg
gcccggctgacaccggagcagatctcttcgctggtcatcgcgtacgagccggtgtgggcg
atcggcaccggcgaggtcgccactccgcaggacgcccaggaggtgtgtggcgcgatccgt
cgctggctggccgagcgctacggcgatgcgaccgccgatcaggtgcggatcctgtacggg
ggttcggtgaaggcgagcaatgtcgcctcgatcatggcccagcccgatgtggatggtgcc
ttggtcggcggtgccagcctcaatccggaggaattcgccgcgatcgcgcgcttctatgat
ctgccgtcgctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system