KEGG   Microlunatus phosphovorus: MLP_14400Help
Entry
MLP_14400         CDS       T01535                                 

Gene name
bdhA
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00072  Synthesis and degradation of ketone bodies
mph00650  Butanoate metabolism
mph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MLP_14400 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MLP_14400 (bdhA)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MLP_14400 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR AdoHcyase_NAD Sacchrp_dh_NADP AlaDh_PNT_C NAD_binding_10 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAK34454
UniProt: F5XQF4
Position
1572361..1573128
Genome map
AA seq 255 aa AA seqDB search
MTTRAEDTPPLTGRTALVTGGASGIGAAIAHRLADLGARVTIADVDPAGAESVAQEIGGD
AWVVDLSDPDALTGGPGRVDVLINNAGIQRVSPIVDFEPEIFHKMLMIMVETPFRLIQSA
LPGMYERGFGRIVNISSVHGLRASEFKSAYVTAKHALEGLSKVTALEGGPHGVTSNCINP
GYVRTPLVEKQIADQARIHGIDESQVVETIMLTHNAIKRLVEPGEVASLVGWLVGPDAAM
VNGASYTMDGGWTAQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccagggctgaggacacaccaccgctgacaggacgaactgcgctggtgacgggt
ggcgcgagcggtatcggcgcggccatcgcccaccggctggccgacctcggcgcccgggtc
accatcgccgatgtcgatccggcgggcgcggaatcagtggctcaggagatcggtggcgac
gcctgggtggtggatctgtccgatccggatgcgctgaccggtggcccgggccgagtggac
gtgctgatcaacaatgcgggcatccagcgggtcagtccgatcgtcgacttcgagccggag
atctttcacaagatgctgatgatcatggtcgagacgccgttccggctgatccagagtgcg
ctgcccggcatgtacgagcgcggcttcggtcggatcgtcaacatctcctcggtgcacggg
ctgcgcgcctcggagttcaaatcggcgtacgtcaccgccaagcacgcgctcgaaggcctg
tccaaggtcactgcgctcgagggcggaccgcacggcgtgaccagcaactgcatcaacccg
ggctacgtacggactccgctggtggagaagcagatcgccgaccaagcccggatccatggc
atcgacgagtcgcaagtggtggagacgatcatgctgacccacaacgcgatcaaacggctg
gtcgagccgggggaggtcgcctcgctggtcggctggctggtcgggccggacgccgcgatg
gtcaacggcgcctcctacacgatggacggtgggtggaccgcccaatga

DBGET integrated database retrieval system