KEGG   Microlunatus phosphovorus: MLP_15250Help
Entry
MLP_15250         CDS       T01535                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mph  Microlunatus phosphovorus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mph00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650253..1652352
Genome map
AA seq 699 aa AA seqDB search
MTELNEPLRELAQAYGIATEYWDWQGQHVSVEAETVIAVLAGLDVDASTPEKAWQALQQH
HREPWTRMLPRCLATRQGHAVSIWVHVTAGDPVDVWVELETGGGRGLRQLENWNPAREID
GRWVGEASFEIPGDLPLGYHTVRARSGGHGGGQEASMPLIITPAWLGLPARLGDRRAWGL
ATQLYSVRSHGSWGGVGDLTDLTDLAVWSGAEHGADYILINPLHAAEPVPPMEPSPYLPS
TRRFFNPLYLRPERIPEYVELTPDQRAAVEALRSEVDTPEAWQSIDRNAAWTAKRAALKI
IFEVPRSAGRQLAFTAFRRRAGEGLERFAQWAVLSEQHGPHFDEWPAELQHPRTAQVAEF
TATHGHEIDFVCWLQWVMDEQLASAQSASEQAGMALGIMHDLAVGVHPHGADAWALKDTY
AQGISVGAPPDPYNQNGQNWSQPPWRPDRLAEQAYAPYREMVRTILRHAGGIRVDHVIGL
FRLWWIPEGAGPTKGTYVRNDHEAMVGILALEAHRAGAVVVGEDLGTVEPWVRDYLRERG
ILGTSILWFEFDFHGDGSPLAPEKWREYCLASVTTHDLPPTAGYLAGDHVRLRDQLGVLT
RPLAEELAVDEAERKAWLDNLRARRGLADDADEEATVAALYRYLTWTRSRLLNVALGDAI
GDHRVQNQPGTVNEYPNWRVPLSGPDGQPVWLEDVLTDR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagctgaatgaaccgctccgagaactcgcgcaggcgtacgggatcgccaccgag
tactgggattggcaggggcagcacgtctcggtcgaggccgagaccgtgatcgccgtgttg
gccggtctggatgtcgacgcatcgaccccggagaaggcctggcaggcgctgcagcagcat
caccgggagccgtggacgaggatgctgccgcgttgtctggccacccggcaagggcacgcg
gtctcgatctgggtgcacgtcacggccggcgatccggtggacgtctgggtcgagctggag
accggtggcgggcgaggactgcggcagctggagaactggaacccggcacgggagatcgac
ggtcgctgggtcggcgaggccagcttcgagatcccgggcgatctgccgctcggttatcac
acggtccgggctcgcagcggtgggcacggcggtggtcaggaagcgtcgatgccgctgatc
atcaccccggcctggctcggtctgccggcgcggctgggggatcggcgggcttggggcctg
gcgacccagctctacagcgtgcgctcgcacggatcctggggcggagtgggtgaccttacc
gatctgaccgacctcgcggtctggtcgggcgcggagcacggcgccgactacatcttgatc
aatccgttgcatgcggccgagccggtgccgccgatggagccgtcgccgtatctgccgagc
acccgccggttcttcaacccgctctatctccgccccgagcggatccccgagtatgtcgag
ctgactcccgaccagcgggccgcggtcgaggcgctccggtccgaggtcgacactccggag
gcgtggcagtccatcgatcgcaatgccgcctggacggccaagcgggctgccttgaagatc
attttcgaggtgccccgctccgccggccggcaattggccttcaccgcattccgccgccgg
gccggtgaaggactggagcggttcgcgcagtgggcggtgttgagcgagcagcacggtccg
catttcgatgagtggccggccgagctgcagcatcccaggacggcccaggtggcggagttc
accgccacccacggccatgagatcgacttcgtgtgctggctgcagtgggtgatggacgag
cagctggccagtgcgcagagcgccagtgagcaggccggcatggcactcggcatcatgcat
gacctggcggtgggtgtgcatccgcacggcgccgatgcctgggcgctcaaggacacctac
gcgcaagggatctcggtcggtgcaccgccggatccgtacaaccagaacgggcagaactgg
agccagccgccctggcgtcccgaccggttggccgagcaggcgtacgcgccgtaccgggag
atggtgcgcaccatcctccgccacgccggagggatccgggtcgaccatgtgatcggcctg
ttccggttgtggtggatccccgagggcgcggggccgaccaagggcacctatgtgcgcaac
gaccatgaggcgatggtcggcatcctggcgctggaggcgcatcgcgcgggcgcggtggtg
gtcggcgaggaccttggcacggtggagccgtgggtgcgggactatctccgagagcgcggc
attctcggcacctcgatcctgtggttcgagttcgacttccatggtgacggatcaccgctg
gcgccggagaaatggcgggaatactgcctcgcctcggtgaccacccacgacctgccgccg
accgccggctatctggccggcgaccacgtacgactgcgtgaccagctgggagtgctgacc
cggccgctggccgaggagctcgcggtcgacgaggccgagcggaaggcctggttggacaac
ctgcgggcccgccgtgggctggccgacgacgcggacgaggaggcgacggtcgctgcgctc
tatcgctatctgacctggacccgctcgcggctgctcaacgtggccctcggcgacgcgatc
ggggaccaccgggtgcagaaccagccgggcacggtgaacgagtacccgaactggcgggtg
ccgttgagcggaccggacggccagccggtctggctggaggacgtgctgaccgaccggtga

DBGET integrated database retrieval system